Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3101
Gene name
Locationscaffold_247:8348..11836
Strand+
Gene length (bp)3488
Transcript length (bp)3405
Coding sequence length (bp)3402
Protein length (aa) 1134

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.6E-06 1042 1106
PF13637 Ank_4 Ankyrin repeats (many copies) 7.6E-05 1046 1096

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 1044 1119 4.0E-06

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.17 0.00 0.39
CcL In ants, during behavior modification 90.33 26.59 154.08
CcD In ants, recently dead 6.65 2.96 10.34

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000535 yes
SC16a CcD 0.000535 yes
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3101
MASRRVVAMNLAMVLILSSSIGQFSAVATEAHAPPTAGLELGAERRPEIDSDLEEDPEGLLHPPRFGRFNSRLRP
FADPHIYVNVRAGQNNGDYVSMDDLRQDAVGDGPNRDPNVDIGGGAGQAEDDYIQMGGLRGNARGHPEPNEPYYA
NMGQNRPDEGPAVEMGNDNSEEPIAGAGGSLPTGSGSSSGSTPDVNYSGWESDTSGESFHFEDEEEPHVSHADDL
AQPNVDSLNDDVSPDYDAPVDAGSNSQNQPFGPRYPQLDDVVPQPASPIAPHGRGRFLGADDDIPFIDAPGVDIY
GGTEHGYEMIESDTDELVGPGPTYETIPPALPDRNSRLDLEGIEAEASGGAAAEEKAVEYVYLCSTQKVSEIKRI
GGVFPRGYRPPQSGSDAGSQTGSSFDLDDYFHGEGQNAYVVTYEDLPDAAQVAAEWTGGGKVRIWKVKTTPNMFP
ESSISGVQATIGERYLAFGGIHKGQMAGYYKLGNEPAQRIQGLRNGVPPKESGFKYVANRGYRPVTYANERNVLP
SEMADETRAELRAMLKLPACRERSGGPSKRSIRKCVWRGGDRDLEKGSGGNEDLEVEEGEDVDLSDAMVEEGLDG
PKAEKMPLSEAGDTNLYDEPFEKMGVSVPESSEAIEAKVLSGSSDDVRVSAQLERTELAAVVDGFAAHTFKDLVK
QLKLKIPKYFNGPVANVASLRRELVQVASIKTWSSRYSGGALWIALTTTYVYDMIRAWREESATELEKVAVTLSL
LPVVGCSFKAMVDRDHGAISPIGTSLCFVGDILLFTPLAPVAVLIRAIGSVVDHAEQNSVDFIVQQHDAGWRKHY
SELEHTLQSETFRLNVSDRYATEMAVIAFQASEQMGMLEASRQIASRRQANMTQADGLELEATTARAREEVKQKM
CGDMRYKKLWFERWLPVVMAYHMRDQATNYTAIFMDRQTDKIMADLDTAQTMASITDFHYPQPPSQAEARKAAVE
AKLRKLGNALGYMKRVEIEIQAQKIQSIVTNLLTTLNFALPDLCDCPSQVKEIQLLTALRDSRDKLEAALLCATS
RGYHDVVDYILQKALYTTDINAVDEDGNSALLLAVANGRTDMAARLLHAGADPNLANKHGQTLASLGADSEQNGV
ATPETKRAK
Coding >Ophio5|3101
ATGGCAAGCCGACGCGTCGTTGCCATGAATTTGGCCATGGTGCTCATTCTATCTTCGTCCATCGGCCAGTTCTCG
GCCGTGGCCACTGAAGCCCACGCTCCGCCAACGGCAGGACTGGAACTTGGTGCCGAACGACGGCCGGAGATTGAC
TCGGATTTAGAGGAAGACCCCGAAGGTCTCCTTCATCCTCCACGCTTTGGACGCTTTAACAGCCGTCTACGTCCG
TTTGCAGATCCTCACATTTATGTCAACGTGAGAGCAGGCCAAAATAATGGTGACTACGTCAGCATGGATGATTTG
AGACAAGACGCCGTCGGTGACGGACCTAACAGGGACCCAAACGTTGACATTGGAGGTGGAGCGGGCCAGGCTGAG
GACGATTATATTCAAATGGGCGGTCTACGGGGAAATGCCCGAGGCCATCCTGAGCCCAACGAACCCTACTATGCC
AACATGGGGCAGAATCGGCCGGACGAAGGACCAGCCGTGGAGATGGGGAATGATAACAGTGAAGAACCTATTGCC
GGGGCCGGAGGCAGTCTTCCGACCGGTTCTGGCTCAAGCTCGGGCAGCACCCCAGACGTCAACTATTCAGGATGG
GAGTCTGATACCAGCGGAGAGTCTTTTCATTTTGAAGACGAGGAGGAACCTCACGTTTCTCACGCTGATGATCTT
GCTCAACCCAACGTCGATTCTCTAAATGATGATGTCAGTCCTGACTACGACGCTCCTGTCGATGCCGGTAGTAAT
TCTCAAAATCAACCTTTCGGTCCTCGATATCCTCAGCTGGATGATGTCGTTCCGCAGCCGGCGTCTCCAATCGCT
CCTCATGGTCGAGGACGATTTCTAGGGGCTGACGACGACATCCCATTCATAGACGCGCCGGGCGTTGATATATAC
GGCGGGACCGAGCATGGCTACGAAATGATCGAGTCGGACACGGATGAATTGGTCGGACCAGGCCCTACATACGAA
ACGATCCCGCCGGCGCTGCCAGACAGAAACAGTCGCTTAGATTTGGAGGGGATAGAGGCCGAAGCAAGTGGCGGC
GCGGCGGCGGAAGAAAAGGCAGTCGAATACGTGTACCTCTGCAGCACGCAAAAAGTGTCCGAGATCAAGCGGATA
GGCGGCGTCTTTCCTCGGGGCTACAGGCCGCCTCAGTCGGGATCCGATGCCGGATCCCAAACCGGCTCCAGCTTC
GACTTGGATGATTACTTCCACGGTGAAGGGCAAAATGCGTACGTTGTTACCTACGAGGATTTACCGGACGCCGCT
CAAGTGGCAGCGGAGTGGACGGGCGGCGGCAAAGTGCGCATCTGGAAGGTCAAGACGACGCCCAACATGTTTCCC
GAGAGCAGCATATCGGGAGTGCAAGCCACCATTGGAGAGCGATATCTAGCCTTTGGGGGTATTCATAAGGGTCAG
ATGGCGGGATATTACAAGCTGGGTAACGAGCCGGCGCAGCGGATTCAGGGGCTACGCAATGGCGTGCCACCCAAG
GAGTCCGGCTTCAAGTACGTCGCCAATCGTGGCTACCGCCCCGTCACGTACGCAAATGAGCGGAACGTGCTTCCC
AGCGAGATGGCAGACGAGACCAGGGCGGAATTGAGGGCGATGCTGAAGTTGCCAGCCTGCCGGGAGCGCTCCGGC
GGTCCGAGTAAGCGATCGATCAGAAAATGCGTCTGGCGCGGGGGCGACAGAGACTTGGAGAAAGGCTCGGGAGGG
AATGAGGATCTCGAGGTCGAAGAAGGAGAAGACGTGGATCTCTCGGATGCCATGGTCGAGGAGGGACTGGATGGT
CCCAAGGCTGAGAAGATGCCCCTCTCCGAGGCCGGTGACACGAACCTCTACGATGAGCCTTTCGAGAAGATGGGT
GTCTCGGTTCCTGAGAGCTCCGAAGCCATAGAGGCGAAAGTCTTGAGCGGCAGCAGCGATGATGTGCGTGTGTCG
GCTCAGCTGGAGCGGACCGAGCTGGCAGCGGTGGTCGATGGCTTCGCCGCCCATACCTTCAAAGACCTGGTGAAG
CAGCTCAAGCTCAAGATTCCCAAGTATTTCAACGGTCCCGTCGCCAACGTGGCCTCTCTGCGGAGGGAGCTCGTG
CAAGTGGCGTCCATCAAGACGTGGTCATCTCGATACAGCGGCGGCGCTCTGTGGATCGCACTCACGACGACGTAC
GTCTACGACATGATCAGAGCCTGGCGTGAAGAGTCGGCAACGGAGCTGGAGAAGGTGGCCGTGACGTTGTCGCTT
CTGCCCGTGGTAGGCTGCTCGTTCAAGGCCATGGTTGATAGAGATCACGGCGCCATCAGCCCCATCGGTACATCG
CTATGCTTCGTCGGCGACATACTGCTCTTCACACCGCTGGCGCCTGTTGCCGTCTTGATTCGCGCCATCGGCAGC
GTCGTCGACCACGCTGAACAGAACAGCGTCGACTTCATCGTCCAGCAGCACGACGCTGGTTGGAGGAAGCATTAC
AGCGAGCTCGAGCATACCCTTCAGTCCGAGACGTTCCGCCTCAACGTCAGCGACCGCTACGCTACGGAAATGGCC
GTCATTGCCTTTCAGGCCTCGGAACAGATGGGCATGCTGGAGGCGAGCAGGCAGATTGCGAGCCGGCGGCAAGCC
AACATGACGCAGGCGGACGGGCTCGAGCTCGAGGCCACGACGGCACGAGCCCGGGAGGAAGTGAAGCAGAAGATG
TGCGGCGATATGCGCTACAAGAAGCTGTGGTTCGAACGCTGGCTTCCCGTCGTCATGGCTTACCACATGCGAGAC
CAGGCCACCAATTACACGGCCATCTTCATGGACCGACAGACGGACAAAATCATGGCGGACCTGGACACGGCTCAG
ACCATGGCTTCCATCACCGACTTTCATTACCCCCAGCCTCCCTCACAAGCTGAAGCACGCAAGGCCGCTGTCGAG
GCCAAACTGAGGAAACTCGGCAACGCACTGGGATACATGAAGCGCGTCGAGATCGAGATTCAGGCCCAGAAGATC
CAAAGCATCGTCACCAACCTTCTCACCACCCTGAACTTCGCCCTGCCCGACTTGTGCGACTGTCCCAGCCAGGTG
AAAGAGATCCAGCTGCTCACGGCCCTTCGCGACTCGCGTGATAAGCTCGAGGCAGCGCTTCTCTGCGCCACGTCC
CGAGGCTACCATGACGTCGTTGACTATATTCTTCAAAAGGCTCTCTACACCACCGACATCAACGCCGTAGACGAA
GACGGCAACTCGGCCCTACTACTGGCCGTCGCCAACGGTCGTACTGACATGGCCGCCAGGTTGCTGCACGCCGGA
GCTGACCCAAACCTGGCCAACAAGCACGGTCAAACCCTGGCGTCTCTGGGCGCCGACTCTGAGCAGAATGGGGTG
GCGACGCCCGAGACAAAAAGGGCAAAG
Transcript >Ophio5|3101
ATGGCAAGCCGACGCGTCGTTGCCATGAATTTGGCCATGGTGCTCATTCTATCTTCGTCCATCGGCCAGTTCTCG
GCCGTGGCCACTGAAGCCCACGCTCCGCCAACGGCAGGACTGGAACTTGGTGCCGAACGACGGCCGGAGATTGAC
TCGGATTTAGAGGAAGACCCCGAAGGTCTCCTTCATCCTCCACGCTTTGGACGCTTTAACAGCCGTCTACGTCCG
TTTGCAGATCCTCACATTTATGTCAACGTGAGAGCAGGCCAAAATAATGGTGACTACGTCAGCATGGATGATTTG
AGACAAGACGCCGTCGGTGACGGACCTAACAGGGACCCAAACGTTGACATTGGAGGTGGAGCGGGCCAGGCTGAG
GACGATTATATTCAAATGGGCGGTCTACGGGGAAATGCCCGAGGCCATCCTGAGCCCAACGAACCCTACTATGCC
AACATGGGGCAGAATCGGCCGGACGAAGGACCAGCCGTGGAGATGGGGAATGATAACAGTGAAGAACCTATTGCC
GGGGCCGGAGGCAGTCTTCCGACCGGTTCTGGCTCAAGCTCGGGCAGCACCCCAGACGTCAACTATTCAGGATGG
GAGTCTGATACCAGCGGAGAGTCTTTTCATTTTGAAGACGAGGAGGAACCTCACGTTTCTCACGCTGATGATCTT
GCTCAACCCAACGTCGATTCTCTAAATGATGATGTCAGTCCTGACTACGACGCTCCTGTCGATGCCGGTAGTAAT
TCTCAAAATCAACCTTTCGGTCCTCGATATCCTCAGCTGGATGATGTCGTTCCGCAGCCGGCGTCTCCAATCGCT
CCTCATGGTCGAGGACGATTTCTAGGGGCTGACGACGACATCCCATTCATAGACGCGCCGGGCGTTGATATATAC
GGCGGGACCGAGCATGGCTACGAAATGATCGAGTCGGACACGGATGAATTGGTCGGACCAGGCCCTACATACGAA
ACGATCCCGCCGGCGCTGCCAGACAGAAACAGTCGCTTAGATTTGGAGGGGATAGAGGCCGAAGCAAGTGGCGGC
GCGGCGGCGGAAGAAAAGGCAGTCGAATACGTGTACCTCTGCAGCACGCAAAAAGTGTCCGAGATCAAGCGGATA
GGCGGCGTCTTTCCTCGGGGCTACAGGCCGCCTCAGTCGGGATCCGATGCCGGATCCCAAACCGGCTCCAGCTTC
GACTTGGATGATTACTTCCACGGTGAAGGGCAAAATGCGTACGTTGTTACCTACGAGGATTTACCGGACGCCGCT
CAAGTGGCAGCGGAGTGGACGGGCGGCGGCAAAGTGCGCATCTGGAAGGTCAAGACGACGCCCAACATGTTTCCC
GAGAGCAGCATATCGGGAGTGCAAGCCACCATTGGAGAGCGATATCTAGCCTTTGGGGGTATTCATAAGGGTCAG
ATGGCGGGATATTACAAGCTGGGTAACGAGCCGGCGCAGCGGATTCAGGGGCTACGCAATGGCGTGCCACCCAAG
GAGTCCGGCTTCAAGTACGTCGCCAATCGTGGCTACCGCCCCGTCACGTACGCAAATGAGCGGAACGTGCTTCCC
AGCGAGATGGCAGACGAGACCAGGGCGGAATTGAGGGCGATGCTGAAGTTGCCAGCCTGCCGGGAGCGCTCCGGC
GGTCCGAGTAAGCGATCGATCAGAAAATGCGTCTGGCGCGGGGGCGACAGAGACTTGGAGAAAGGCTCGGGAGGG
AATGAGGATCTCGAGGTCGAAGAAGGAGAAGACGTGGATCTCTCGGATGCCATGGTCGAGGAGGGACTGGATGGT
CCCAAGGCTGAGAAGATGCCCCTCTCCGAGGCCGGTGACACGAACCTCTACGATGAGCCTTTCGAGAAGATGGGT
GTCTCGGTTCCTGAGAGCTCCGAAGCCATAGAGGCGAAAGTCTTGAGCGGCAGCAGCGATGATGTGCGTGTGTCG
GCTCAGCTGGAGCGGACCGAGCTGGCAGCGGTGGTCGATGGCTTCGCCGCCCATACCTTCAAAGACCTGGTGAAG
CAGCTCAAGCTCAAGATTCCCAAGTATTTCAACGGTCCCGTCGCCAACGTGGCCTCTCTGCGGAGGGAGCTCGTG
CAAGTGGCGTCCATCAAGACGTGGTCATCTCGATACAGCGGCGGCGCTCTGTGGATCGCACTCACGACGACGTAC
GTCTACGACATGATCAGAGCCTGGCGTGAAGAGTCGGCAACGGAGCTGGAGAAGGTGGCCGTGACGTTGTCGCTT
CTGCCCGTGGTAGGCTGCTCGTTCAAGGCCATGGTTGATAGAGATCACGGCGCCATCAGCCCCATCGGTACATCG
CTATGCTTCGTCGGCGACATACTGCTCTTCACACCGCTGGCGCCTGTTGCCGTCTTGATTCGCGCCATCGGCAGC
GTCGTCGACCACGCTGAACAGAACAGCGTCGACTTCATCGTCCAGCAGCACGACGCTGGTTGGAGGAAGCATTAC
AGCGAGCTCGAGCATACCCTTCAGTCCGAGACGTTCCGCCTCAACGTCAGCGACCGCTACGCTACGGAAATGGCC
GTCATTGCCTTTCAGGCCTCGGAACAGATGGGCATGCTGGAGGCGAGCAGGCAGATTGCGAGCCGGCGGCAAGCC
AACATGACGCAGGCGGACGGGCTCGAGCTCGAGGCCACGACGGCACGAGCCCGGGAGGAAGTGAAGCAGAAGATG
TGCGGCGATATGCGCTACAAGAAGCTGTGGTTCGAACGCTGGCTTCCCGTCGTCATGGCTTACCACATGCGAGAC
CAGGCCACCAATTACACGGCCATCTTCATGGACCGACAGACGGACAAAATCATGGCGGACCTGGACACGGCTCAG
ACCATGGCTTCCATCACCGACTTTCATTACCCCCAGCCTCCCTCACAAGCTGAAGCACGCAAGGCCGCTGTCGAG
GCCAAACTGAGGAAACTCGGCAACGCACTGGGATACATGAAGCGCGTCGAGATCGAGATTCAGGCCCAGAAGATC
CAAAGCATCGTCACCAACCTTCTCACCACCCTGAACTTCGCCCTGCCCGACTTGTGCGACTGTCCCAGCCAGGTG
AAAGAGATCCAGCTGCTCACGGCCCTTCGCGACTCGCGTGATAAGCTCGAGGCAGCGCTTCTCTGCGCCACGTCC
CGAGGCTACCATGACGTCGTTGACTATATTCTTCAAAAGGCTCTCTACACCACCGACATCAACGCCGTAGACGAA
GACGGCAACTCGGCCCTACTACTGGCCGTCGCCAACGGTCGTACTGACATGGCCGCCAGGTTGCTGCACGCCGGA
GCTGACCCAAACCTGGCCAACAAGCACGGTCAAACCCTGGCGTCTCTGGGCGCCGACTCTGAGCAGAATGGGGTG
GCGACGCCCGAGACAAAAAGGGCAAAGTGA
Gene >Ophio5|3101
ATGGCAAGCCGACGCGTCGTTGCCATGAATTTGGCCATGGTGCTCATTCTATCTTCGTCCATCGGCCAGTTCTCG
GCCGTGGCCACTGAAGCCCACGCTCCGCCAACGGCAGGACTGGAACTTGGTGCCGAACGACGGCCGGAGATTGAC
TCGGTACGAGGAGGCCTGCTTCGTTCCTCTCGCGGCTTCATCCGCTTTTCAGCGTGATAGAACTGACTACGTGTT
GTTTTTTCTAGGATTTAGAGGAAGACCCCGAAGGTCTCCTTCATCCTCCACGCTTTGGACGCTTTAACAGCCGTC
TACGTCCGTTTGCAGATCCTCACATTTATGTCAACGTGAGAGCAGGCCAAAATAATGGTGACTACGTCAGCATGG
ATGATTTGAGACAAGACGCCGTCGGTGACGGACCTAACAGGGACCCAAACGTTGACATTGGAGGTGGAGCGGGCC
AGGCTGAGGACGATTATATTCAAATGGGCGGTCTACGGGGAAATGCCCGAGGCCATCCTGAGCCCAACGAACCCT
ACTATGCCAACATGGGGCAGAATCGGCCGGACGAAGGACCAGCCGTGGAGATGGGGAATGATAACAGTGAAGAAC
CTATTGCCGGGGCCGGAGGCAGTCTTCCGACCGGTTCTGGCTCAAGCTCGGGCAGCACCCCAGACGTCAACTATT
CAGGATGGGAGTCTGATACCAGCGGAGAGTCTTTTCATTTTGAAGACGAGGAGGAACCTCACGTTTCTCACGCTG
ATGATCTTGCTCAACCCAACGTCGATTCTCTAAATGATGATGTCAGTCCTGACTACGACGCTCCTGTCGATGCCG
GTAGTAATTCTCAAAATCAACCTTTCGGTCCTCGATATCCTCAGCTGGATGATGTCGTTCCGCAGCCGGCGTCTC
CAATCGCTCCTCATGGTCGAGGACGATTTCTAGGGGCTGACGACGACATCCCATTCATAGACGCGCCGGGCGTTG
ATATATACGGCGGGACCGAGCATGGCTACGAAATGATCGAGTCGGACACGGATGAATTGGTCGGACCAGGCCCTA
CATACGAAACGATCCCGCCGGCGCTGCCAGACAGAAACAGTCGCTTAGATTTGGAGGGGATAGAGGCCGAAGCAA
GTGGCGGCGCGGCGGCGGAAGAAAAGGCAGTCGAATACGTGTACCTCTGCAGCACGCAAAAAGTGTCCGAGATCA
AGCGGATAGGCGGCGTCTTTCCTCGGGGCTACAGGCCGCCTCAGTCGGGATCCGATGCCGGATCCCAAACCGGCT
CCAGCTTCGACTTGGATGATTACTTCCACGGTGAAGGGCAAAATGCGTACGTTGTTACCTACGAGGATTTACCGG
ACGCCGCTCAAGTGGCAGCGGAGTGGACGGGCGGCGGCAAAGTGCGCATCTGGAAGGTCAAGACGACGCCCAACA
TGTTTCCCGAGAGCAGCATATCGGGAGTGCAAGCCACCATTGGAGAGCGATATCTAGCCTTTGGGGGTATTCATA
AGGGTCAGATGGCGGGATATTACAAGCTGGGTAACGAGCCGGCGCAGCGGATTCAGGGGCTACGCAATGGCGTGC
CACCCAAGGAGTCCGGCTTCAAGTACGTCGCCAATCGTGGCTACCGCCCCGTCACGTACGCAAATGAGCGGAACG
TGCTTCCCAGCGAGATGGCAGACGAGACCAGGGCGGAATTGAGGGCGATGCTGAAGTTGCCAGCCTGCCGGGAGC
GCTCCGGCGGTCCGAGTAAGCGATCGATCAGAAAATGCGTCTGGCGCGGGGGCGACAGAGACTTGGAGAAAGGCT
CGGGAGGGAATGAGGATCTCGAGGTCGAAGAAGGAGAAGACGTGGATCTCTCGGATGCCATGGTCGAGGAGGGAC
TGGATGGTCCCAAGGCTGAGAAGATGCCCCTCTCCGAGGCCGGTGACACGAACCTCTACGATGAGCCTTTCGAGA
AGATGGGTGTCTCGGTTCCTGAGAGCTCCGAAGCCATAGAGGCGAAAGTCTTGAGCGGCAGCAGCGATGATGTGC
GTGTGTCGGCTCAGCTGGAGCGGACCGAGCTGGCAGCGGTGGTCGATGGCTTCGCCGCCCATACCTTCAAAGACC
TGGTGAAGCAGCTCAAGCTCAAGATTCCCAAGTATTTCAACGGTCCCGTCGCCAACGTGGCCTCTCTGCGGAGGG
AGCTCGTGCAAGTGGCGTCCATCAAGACGTGGTCATCTCGATACAGCGGCGGCGCTCTGTGGATCGCACTCACGA
CGACGTACGTCTACGACATGATCAGAGCCTGGCGTGAAGAGTCGGCAACGGAGCTGGAGAAGGTGGCCGTGACGT
TGTCGCTTCTGCCCGTGGTAGGCTGCTCGTTCAAGGCCATGGTTGATAGAGATCACGGCGCCATCAGCCCCATCG
GTACATCGCTATGCTTCGTCGGCGACATACTGCTCTTCACACCGCTGGCGCCTGTTGCCGTCTTGATTCGCGCCA
TCGGCAGCGTCGTCGACCACGCTGAACAGAACAGCGTCGACTTCATCGTCCAGCAGCACGACGCTGGTTGGAGGA
AGCATTACAGCGAGCTCGAGCATACCCTTCAGTCCGAGACGTTCCGCCTCAACGTCAGCGACCGCTACGCTACGG
AAATGGCCGTCATTGCCTTTCAGGCCTCGGAACAGATGGGCATGCTGGAGGCGAGCAGGCAGATTGCGAGCCGGC
GGCAAGCCAACATGACGCAGGCGGACGGGCTCGAGCTCGAGGCCACGACGGCACGAGCCCGGGAGGAAGTGAAGC
AGAAGATGTGCGGCGATATGCGCTACAAGAAGCTGTGGTTCGAACGCTGGCTTCCCGTCGTCATGGCTTACCACA
TGCGAGACCAGGCCACCAATTACACGGCCATCTTCATGGACCGACAGACGGACAAAATCATGGCGGACCTGGACA
CGGCTCAGACCATGGCTTCCATCACCGACTTTCATTACCCCCAGCCTCCCTCACAAGCTGAAGCACGCAAGGCCG
CTGTCGAGGCCAAACTGAGGAAACTCGGCAACGCACTGGGATACATGAAGCGCGTCGAGATCGAGATTCAGGCCC
AGAAGATCCAAAGCATCGTCACCAACCTTCTCACCACCCTGAACTTCGCCCTGCCCGACTTGTGCGACTGTCCCA
GCCAGGTGAAAGAGATCCAGCTGCTCACGGCCCTTCGCGACTCGCGTGATAAGCTCGAGGCAGCGCTTCTCTGCG
CCACGTCCCGAGGCTACCATGACGTCGTTGACTATATTCTTCAAAAGGCTCTCTACACCACCGACATCAACGCCG
TAGACGAAGACGGCAACTCGGCCCTACTACTGGCCGTCGCCAACGGTCGTACTGACATGGCCGCCAGGTTGCTGC
ACGCCGGAGCTGACCCAAACCTGGCCAACAAGCACGGTCAAACCCTGGCGTCTCTGGGCGCCGACTCTGAGCAGA
ATGGGGTGGCGACGCCCGAGACAAAAAGGGCAAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail