Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3101
Gene name
Locationscaffold_247:8348..11836
Strand+
Gene length (bp)3488
Transcript length (bp)3405
Coding sequence length (bp)3402
Protein length (aa) 1134

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.6E-06 1042 1106
PF13637 Ank_4 Ankyrin repeats (many copies) 7.6E-05 1046 1096

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 1044 1119 4.0E-06

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3101
MASRRVVAMNLAMVLILSSSIGQFSAVATEAHAPPTAGLELGAERRPEIDSDLEEDPEGLLHPPRFGRFNSRLRP
FADPHIYVNVRAGQNNGDYVSMDDLRQDAVGDGPNRDPNVDIGGGAGQAEDDYIQMGGLRGNARGHPEPNEPYYA
NMGQNRPDEGPAVEMGNDNSEEPIAGAGGSLPTGSGSSSGSTPDVNYSGWESDTSGESFHFEDEEEPHVSHADDL
AQPNVDSLNDDVSPDYDAPVDAGSNSQNQPFGPRYPQLDDVVPQPASPIAPHGRGRFLGADDDIPFIDAPGVDIY
GGTEHGYEMIESDTDELVGPGPTYETIPPALPDRNSRLDLEGIEAEASGGAAAEEKAVEYVYLCSTQKVSEIKRI
GGVFPRGYRPPQSGSDAGSQTGSSFDLDDYFHGEGQNAYVVTYEDLPDAAQVAAEWTGGGKVRIWKVKTTPNMFP
ESSISGVQATIGERYLAFGGIHKGQMAGYYKLGNEPAQRIQGLRNGVPPKESGFKYVANRGYRPVTYANERNVLP
SEMADETRAELRAMLKLPACRERSGGPSKRSIRKCVWRGGDRDLEKGSGGNEDLEVEEGEDVDLSDAMVEEGLDG
PKAEKMPLSEAGDTNLYDEPFEKMGVSVPESSEAIEAKVLSGSSDDVRVSAQLERTELAAVVDGFAAHTFKDLVK
QLKLKIPKYFNGPVANVASLRRELVQVASIKTWSSRYSGGALWIALTTTYVYDMIRAWREESATELEKVAVTLSL
LPVVGCSFKAMVDRDHGAISPIGTSLCFVGDILLFTPLAPVAVLIRAIGSVVDHAEQNSVDFIVQQHDAGWRKHY
SELEHTLQSETFRLNVSDRYATEMAVIAFQASEQMGMLEASRQIASRRQANMTQADGLELEATTARAREEVKQKM
CGDMRYKKLWFERWLPVVMAYHMRDQATNYTAIFMDRQTDKIMADLDTAQTMASITDFHYPQPPSQAEARKAAVE
AKLRKLGNALGYMKRVEIEIQAQKIQSIVTNLLTTLNFALPDLCDCPSQVKEIQLLTALRDSRDKLEAALLCATS
RGYHDVVDYILQKALYTTDINAVDEDGNSALLLAVANGRTDMAARLLHAGADPNLANKHGQTLASLGADSEQNGV
ATPETKRAK
Coding >Ophio5|3101
ATGGCAAGCCGACGCGTCGTTGCCATGAATTTGGCCATGGTGCTCATTCTATCTTCGTCCATCGGCCAGTTCTCG
GCCGTGGCCACTGAAGCCCACGCTCCGCCAACGGCAGGACTGGAACTTGGTGCCGAACGACGGCCGGAGATTGAC
TCGGATTTAGAGGAAGACCCCGAAGGTCTCCTTCATCCTCCACGCTTTGGACGCTTTAACAGCCGTCTACGTCCG
TTTGCAGATCCTCACATTTATGTCAACGTGAGAGCAGGCCAAAATAATGGTGACTACGTCAGCATGGATGATTTG
AGACAAGACGCCGTCGGTGACGGACCTAACAGGGACCCAAACGTTGACATTGGAGGTGGAGCGGGCCAGGCTGAG
GACGATTATATTCAAATGGGCGGTCTACGGGGAAATGCCCGAGGCCATCCTGAGCCCAACGAACCCTACTATGCC
AACATGGGGCAGAATCGGCCGGACGAAGGACCAGCCGTGGAGATGGGGAATGATAACAGTGAAGAACCTATTGCC
GGGGCCGGAGGCAGTCTTCCGACCGGTTCTGGCTCAAGCTCGGGCAGCACCCCAGACGTCAACTATTCAGGATGG
GAGTCTGATACCAGCGGAGAGTCTTTTCATTTTGAAGACGAGGAGGAACCTCACGTTTCTCACGCTGATGATCTT
GCTCAACCCAACGTCGATTCTCTAAATGATGATGTCAGTCCTGACTACGACGCTCCTGTCGATGCCGGTAGTAAT
TCTCAAAATCAACCTTTCGGTCCTCGATATCCTCAGCTGGATGATGTCGTTCCGCAGCCGGCGTCTCCAATCGCT
CCTCATGGTCGAGGACGATTTCTAGGGGCTGACGACGACATCCCATTCATAGACGCGCCGGGCGTTGATATATAC
GGCGGGACCGAGCATGGCTACGAAATGATCGAGTCGGACACGGATGAATTGGTCGGACCAGGCCCTACATACGAA
ACGATCCCGCCGGCGCTGCCAGACAGAAACAGTCGCTTAGATTTGGAGGGGATAGAGGCCGAAGCAAGTGGCGGC
GCGGCGGCGGAAGAAAAGGCAGTCGAATACGTGTACCTCTGCAGCACGCAAAAAGTGTCCGAGATCAAGCGGATA
GGCGGCGTCTTTCCTCGGGGCTACAGGCCGCCTCAGTCGGGATCCGATGCCGGATCCCAAACCGGCTCCAGCTTC
GACTTGGATGATTACTTCCACGGTGAAGGGCAAAATGCGTACGTTGTTACCTACGAGGATTTACCGGACGCCGCT
CAAGTGGCAGCGGAGTGGACGGGCGGCGGCAAAGTGCGCATCTGGAAGGTCAAGACGACGCCCAACATGTTTCCC
GAGAGCAGCATATCGGGAGTGCAAGCCACCATTGGAGAGCGATATCTAGCCTTTGGGGGTATTCATAAGGGTCAG
ATGGCGGGATATTACAAGCTGGGTAACGAGCCGGCGCAGCGGATTCAGGGGCTACGCAATGGCGTGCCACCCAAG
GAGTCCGGCTTCAAGTACGTCGCCAATCGTGGCTACCGCCCCGTCACGTACGCAAATGAGCGGAACGTGCTTCCC
AGCGAGATGGCAGACGAGACCAGGGCGGAATTGAGGGCGATGCTGAAGTTGCCAGCCTGCCGGGAGCGCTCCGGC
GGTCCGAGTAAGCGATCGATCAGAAAATGCGTCTGGCGCGGGGGCGACAGAGACTTGGAGAAAGGCTCGGGAGGG
AATGAGGATCTCGAGGTCGAAGAAGGAGAAGACGTGGATCTCTCGGATGCCATGGTCGAGGAGGGACTGGATGGT
CCCAAGGCTGAGAAGATGCCCCTCTCCGAGGCCGGTGACACGAACCTCTACGATGAGCCTTTCGAGAAGATGGGT
GTCTCGGTTCCTGAGAGCTCCGAAGCCATAGAGGCGAAAGTCTTGAGCGGCAGCAGCGATGATGTGCGTGTGTCG
GCTCAGCTGGAGCGGACCGAGCTGGCAGCGGTGGTCGATGGCTTCGCCGCCCATACCTTCAAAGACCTGGTGAAG
CAGCTCAAGCTCAAGATTCCCAAGTATTTCAACGGTCCCGTCGCCAACGTGGCCTCTCTGCGGAGGGAGCTCGTG
CAAGTGGCGTCCATCAAGACGTGGTCATCTCGATACAGCGGCGGCGCTCTGTGGATCGCACTCACGACGACGTAC
GTCTACGACATGATCAGAGCCTGGCGTGAAGAGTCGGCAACGGAGCTGGAGAAGGTGGCCGTGACGTTGTCGCTT
CTGCCCGTGGTAGGCTGCTCGTTCAAGGCCATGGTTGATAGAGATCACGGCGCCATCAGCCCCATCGGTACATCG
CTATGCTTCGTCGGCGACATACTGCTCTTCACACCGCTGGCGCCTGTTGCCGTCTTGATTCGCGCCATCGGCAGC
GTCGTCGACCACGCTGAACAGAACAGCGTCGACTTCATCGTCCAGCAGCACGACGCTGGTTGGAGGAAGCATTAC
AGCGAGCTCGAGCATACCCTTCAGTCCGAGACGTTCCGCCTCAACGTCAGCGACCGCTACGCTACGGAAATGGCC
GTCATTGCCTTTCAGGCCTCGGAACAGATGGGCATGCTGGAGGCGAGCAGGCAGATTGCGAGCCGGCGGCAAGCC
AACATGACGCAGGCGGACGGGCTCGAGCTCGAGGCCACGACGGCACGAGCCCGGGAGGAAGTGAAGCAGAAGATG
TGCGGCGATATGCGCTACAAGAAGCTGTGGTTCGAACGCTGGCTTCCCGTCGTCATGGCTTACCACATGCGAGAC
CAGGCCACCAATTACACGGCCATCTTCATGGACCGACAGACGGACAAAATCATGGCGGACCTGGACACGGCTCAG
ACCATGGCTTCCATCACCGACTTTCATTACCCCCAGCCTCCCTCACAAGCTGAAGCACGCAAGGCCGCTGTCGAG
GCCAAACTGAGGAAACTCGGCAACGCACTGGGATACATGAAGCGCGTCGAGATCGAGATTCAGGCCCAGAAGATC
CAAAGCATCGTCACCAACCTTCTCACCACCCTGAACTTCGCCCTGCCCGACTTGTGCGACTGTCCCAGCCAGGTG
AAAGAGATCCAGCTGCTCACGGCCCTTCGCGACTCGCGTGATAAGCTCGAGGCAGCGCTTCTCTGCGCCACGTCC
CGAGGCTACCATGACGTCGTTGACTATATTCTTCAAAAGGCTCTCTACACCACCGACATCAACGCCGTAGACGAA
GACGGCAACTCGGCCCTACTACTGGCCGTCGCCAACGGTCGTACTGACATGGCCGCCAGGTTGCTGCACGCCGGA
GCTGACCCAAACCTGGCCAACAAGCACGGTCAAACCCTGGCGTCTCTGGGCGCCGACTCTGAGCAGAATGGGGTG
GCGACGCCCGAGACAAAAAGGGCAAAG
Transcript >Ophio5|3101
ATGGCAAGCCGACGCGTCGTTGCCATGAATTTGGCCATGGTGCTCATTCTATCTTCGTCCATCGGCCAGTTCTCG
GCCGTGGCCACTGAAGCCCACGCTCCGCCAACGGCAGGACTGGAACTTGGTGCCGAACGACGGCCGGAGATTGAC
TCGGATTTAGAGGAAGACCCCGAAGGTCTCCTTCATCCTCCACGCTTTGGACGCTTTAACAGCCGTCTACGTCCG
TTTGCAGATCCTCACATTTATGTCAACGTGAGAGCAGGCCAAAATAATGGTGACTACGTCAGCATGGATGATTTG
AGACAAGACGCCGTCGGTGACGGACCTAACAGGGACCCAAACGTTGACATTGGAGGTGGAGCGGGCCAGGCTGAG
GACGATTATATTCAAATGGGCGGTCTACGGGGAAATGCCCGAGGCCATCCTGAGCCCAACGAACCCTACTATGCC
AACATGGGGCAGAATCGGCCGGACGAAGGACCAGCCGTGGAGATGGGGAATGATAACAGTGAAGAACCTATTGCC
GGGGCCGGAGGCAGTCTTCCGACCGGTTCTGGCTCAAGCTCGGGCAGCACCCCAGACGTCAACTATTCAGGATGG
GAGTCTGATACCAGCGGAGAGTCTTTTCATTTTGAAGACGAGGAGGAACCTCACGTTTCTCACGCTGATGATCTT
GCTCAACCCAACGTCGATTCTCTAAATGATGATGTCAGTCCTGACTACGACGCTCCTGTCGATGCCGGTAGTAAT
TCTCAAAATCAACCTTTCGGTCCTCGATATCCTCAGCTGGATGATGTCGTTCCGCAGCCGGCGTCTCCAATCGCT
CCTCATGGTCGAGGACGATTTCTAGGGGCTGACGACGACATCCCATTCATAGACGCGCCGGGCGTTGATATATAC
GGCGGGACCGAGCATGGCTACGAAATGATCGAGTCGGACACGGATGAATTGGTCGGACCAGGCCCTACATACGAA
ACGATCCCGCCGGCGCTGCCAGACAGAAACAGTCGCTTAGATTTGGAGGGGATAGAGGCCGAAGCAAGTGGCGGC
GCGGCGGCGGAAGAAAAGGCAGTCGAATACGTGTACCTCTGCAGCACGCAAAAAGTGTCCGAGATCAAGCGGATA
GGCGGCGTCTTTCCTCGGGGCTACAGGCCGCCTCAGTCGGGATCCGATGCCGGATCCCAAACCGGCTCCAGCTTC
GACTTGGATGATTACTTCCACGGTGAAGGGCAAAATGCGTACGTTGTTACCTACGAGGATTTACCGGACGCCGCT
CAAGTGGCAGCGGAGTGGACGGGCGGCGGCAAAGTGCGCATCTGGAAGGTCAAGACGACGCCCAACATGTTTCCC
GAGAGCAGCATATCGGGAGTGCAAGCCACCATTGGAGAGCGATATCTAGCCTTTGGGGGTATTCATAAGGGTCAG
ATGGCGGGATATTACAAGCTGGGTAACGAGCCGGCGCAGCGGATTCAGGGGCTACGCAATGGCGTGCCACCCAAG
GAGTCCGGCTTCAAGTACGTCGCCAATCGTGGCTACCGCCCCGTCACGTACGCAAATGAGCGGAACGTGCTTCCC
AGCGAGATGGCAGACGAGACCAGGGCGGAATTGAGGGCGATGCTGAAGTTGCCAGCCTGCCGGGAGCGCTCCGGC
GGTCCGAGTAAGCGATCGATCAGAAAATGCGTCTGGCGCGGGGGCGACAGAGACTTGGAGAAAGGCTCGGGAGGG
AATGAGGATCTCGAGGTCGAAGAAGGAGAAGACGTGGATCTCTCGGATGCCATGGTCGAGGAGGGACTGGATGGT
CCCAAGGCTGAGAAGATGCCCCTCTCCGAGGCCGGTGACACGAACCTCTACGATGAGCCTTTCGAGAAGATGGGT
GTCTCGGTTCCTGAGAGCTCCGAAGCCATAGAGGCGAAAGTCTTGAGCGGCAGCAGCGATGATGTGCGTGTGTCG
GCTCAGCTGGAGCGGACCGAGCTGGCAGCGGTGGTCGATGGCTTCGCCGCCCATACCTTCAAAGACCTGGTGAAG
CAGCTCAAGCTCAAGATTCCCAAGTATTTCAACGGTCCCGTCGCCAACGTGGCCTCTCTGCGGAGGGAGCTCGTG
CAAGTGGCGTCCATCAAGACGTGGTCATCTCGATACAGCGGCGGCGCTCTGTGGATCGCACTCACGACGACGTAC
GTCTACGACATGATCAGAGCCTGGCGTGAAGAGTCGGCAACGGAGCTGGAGAAGGTGGCCGTGACGTTGTCGCTT
CTGCCCGTGGTAGGCTGCTCGTTCAAGGCCATGGTTGATAGAGATCACGGCGCCATCAGCCCCATCGGTACATCG
CTATGCTTCGTCGGCGACATACTGCTCTTCACACCGCTGGCGCCTGTTGCCGTCTTGATTCGCGCCATCGGCAGC
GTCGTCGACCACGCTGAACAGAACAGCGTCGACTTCATCGTCCAGCAGCACGACGCTGGTTGGAGGAAGCATTAC
AGCGAGCTCGAGCATACCCTTCAGTCCGAGACGTTCCGCCTCAACGTCAGCGACCGCTACGCTACGGAAATGGCC
GTCATTGCCTTTCAGGCCTCGGAACAGATGGGCATGCTGGAGGCGAGCAGGCAGATTGCGAGCCGGCGGCAAGCC
AACATGACGCAGGCGGACGGGCTCGAGCTCGAGGCCACGACGGCACGAGCCCGGGAGGAAGTGAAGCAGAAGATG
TGCGGCGATATGCGCTACAAGAAGCTGTGGTTCGAACGCTGGCTTCCCGTCGTCATGGCTTACCACATGCGAGAC
CAGGCCACCAATTACACGGCCATCTTCATGGACCGACAGACGGACAAAATCATGGCGGACCTGGACACGGCTCAG
ACCATGGCTTCCATCACCGACTTTCATTACCCCCAGCCTCCCTCACAAGCTGAAGCACGCAAGGCCGCTGTCGAG
GCCAAACTGAGGAAACTCGGCAACGCACTGGGATACATGAAGCGCGTCGAGATCGAGATTCAGGCCCAGAAGATC
CAAAGCATCGTCACCAACCTTCTCACCACCCTGAACTTCGCCCTGCCCGACTTGTGCGACTGTCCCAGCCAGGTG
AAAGAGATCCAGCTGCTCACGGCCCTTCGCGACTCGCGTGATAAGCTCGAGGCAGCGCTTCTCTGCGCCACGTCC
CGAGGCTACCATGACGTCGTTGACTATATTCTTCAAAAGGCTCTCTACACCACCGACATCAACGCCGTAGACGAA
GACGGCAACTCGGCCCTACTACTGGCCGTCGCCAACGGTCGTACTGACATGGCCGCCAGGTTGCTGCACGCCGGA
GCTGACCCAAACCTGGCCAACAAGCACGGTCAAACCCTGGCGTCTCTGGGCGCCGACTCTGAGCAGAATGGGGTG
GCGACGCCCGAGACAAAAAGGGCAAAGTGA
Gene >Ophio5|3101
ATGGCAAGCCGACGCGTCGTTGCCATGAATTTGGCCATGGTGCTCATTCTATCTTCGTCCATCGGCCAGTTCTCG
GCCGTGGCCACTGAAGCCCACGCTCCGCCAACGGCAGGACTGGAACTTGGTGCCGAACGACGGCCGGAGATTGAC
TCGGTACGAGGAGGCCTGCTTCGTTCCTCTCGCGGCTTCATCCGCTTTTCAGCGTGATAGAACTGACTACGTGTT
GTTTTTTCTAGGATTTAGAGGAAGACCCCGAAGGTCTCCTTCATCCTCCACGCTTTGGACGCTTTAACAGCCGTC
TACGTCCGTTTGCAGATCCTCACATTTATGTCAACGTGAGAGCAGGCCAAAATAATGGTGACTACGTCAGCATGG
ATGATTTGAGACAAGACGCCGTCGGTGACGGACCTAACAGGGACCCAAACGTTGACATTGGAGGTGGAGCGGGCC
AGGCTGAGGACGATTATATTCAAATGGGCGGTCTACGGGGAAATGCCCGAGGCCATCCTGAGCCCAACGAACCCT
ACTATGCCAACATGGGGCAGAATCGGCCGGACGAAGGACCAGCCGTGGAGATGGGGAATGATAACAGTGAAGAAC
CTATTGCCGGGGCCGGAGGCAGTCTTCCGACCGGTTCTGGCTCAAGCTCGGGCAGCACCCCAGACGTCAACTATT
CAGGATGGGAGTCTGATACCAGCGGAGAGTCTTTTCATTTTGAAGACGAGGAGGAACCTCACGTTTCTCACGCTG
ATGATCTTGCTCAACCCAACGTCGATTCTCTAAATGATGATGTCAGTCCTGACTACGACGCTCCTGTCGATGCCG
GTAGTAATTCTCAAAATCAACCTTTCGGTCCTCGATATCCTCAGCTGGATGATGTCGTTCCGCAGCCGGCGTCTC
CAATCGCTCCTCATGGTCGAGGACGATTTCTAGGGGCTGACGACGACATCCCATTCATAGACGCGCCGGGCGTTG
ATATATACGGCGGGACCGAGCATGGCTACGAAATGATCGAGTCGGACACGGATGAATTGGTCGGACCAGGCCCTA
CATACGAAACGATCCCGCCGGCGCTGCCAGACAGAAACAGTCGCTTAGATTTGGAGGGGATAGAGGCCGAAGCAA
GTGGCGGCGCGGCGGCGGAAGAAAAGGCAGTCGAATACGTGTACCTCTGCAGCACGCAAAAAGTGTCCGAGATCA
AGCGGATAGGCGGCGTCTTTCCTCGGGGCTACAGGCCGCCTCAGTCGGGATCCGATGCCGGATCCCAAACCGGCT
CCAGCTTCGACTTGGATGATTACTTCCACGGTGAAGGGCAAAATGCGTACGTTGTTACCTACGAGGATTTACCGG
ACGCCGCTCAAGTGGCAGCGGAGTGGACGGGCGGCGGCAAAGTGCGCATCTGGAAGGTCAAGACGACGCCCAACA
TGTTTCCCGAGAGCAGCATATCGGGAGTGCAAGCCACCATTGGAGAGCGATATCTAGCCTTTGGGGGTATTCATA
AGGGTCAGATGGCGGGATATTACAAGCTGGGTAACGAGCCGGCGCAGCGGATTCAGGGGCTACGCAATGGCGTGC
CACCCAAGGAGTCCGGCTTCAAGTACGTCGCCAATCGTGGCTACCGCCCCGTCACGTACGCAAATGAGCGGAACG
TGCTTCCCAGCGAGATGGCAGACGAGACCAGGGCGGAATTGAGGGCGATGCTGAAGTTGCCAGCCTGCCGGGAGC
GCTCCGGCGGTCCGAGTAAGCGATCGATCAGAAAATGCGTCTGGCGCGGGGGCGACAGAGACTTGGAGAAAGGCT
CGGGAGGGAATGAGGATCTCGAGGTCGAAGAAGGAGAAGACGTGGATCTCTCGGATGCCATGGTCGAGGAGGGAC
TGGATGGTCCCAAGGCTGAGAAGATGCCCCTCTCCGAGGCCGGTGACACGAACCTCTACGATGAGCCTTTCGAGA
AGATGGGTGTCTCGGTTCCTGAGAGCTCCGAAGCCATAGAGGCGAAAGTCTTGAGCGGCAGCAGCGATGATGTGC
GTGTGTCGGCTCAGCTGGAGCGGACCGAGCTGGCAGCGGTGGTCGATGGCTTCGCCGCCCATACCTTCAAAGACC
TGGTGAAGCAGCTCAAGCTCAAGATTCCCAAGTATTTCAACGGTCCCGTCGCCAACGTGGCCTCTCTGCGGAGGG
AGCTCGTGCAAGTGGCGTCCATCAAGACGTGGTCATCTCGATACAGCGGCGGCGCTCTGTGGATCGCACTCACGA
CGACGTACGTCTACGACATGATCAGAGCCTGGCGTGAAGAGTCGGCAACGGAGCTGGAGAAGGTGGCCGTGACGT
TGTCGCTTCTGCCCGTGGTAGGCTGCTCGTTCAAGGCCATGGTTGATAGAGATCACGGCGCCATCAGCCCCATCG
GTACATCGCTATGCTTCGTCGGCGACATACTGCTCTTCACACCGCTGGCGCCTGTTGCCGTCTTGATTCGCGCCA
TCGGCAGCGTCGTCGACCACGCTGAACAGAACAGCGTCGACTTCATCGTCCAGCAGCACGACGCTGGTTGGAGGA
AGCATTACAGCGAGCTCGAGCATACCCTTCAGTCCGAGACGTTCCGCCTCAACGTCAGCGACCGCTACGCTACGG
AAATGGCCGTCATTGCCTTTCAGGCCTCGGAACAGATGGGCATGCTGGAGGCGAGCAGGCAGATTGCGAGCCGGC
GGCAAGCCAACATGACGCAGGCGGACGGGCTCGAGCTCGAGGCCACGACGGCACGAGCCCGGGAGGAAGTGAAGC
AGAAGATGTGCGGCGATATGCGCTACAAGAAGCTGTGGTTCGAACGCTGGCTTCCCGTCGTCATGGCTTACCACA
TGCGAGACCAGGCCACCAATTACACGGCCATCTTCATGGACCGACAGACGGACAAAATCATGGCGGACCTGGACA
CGGCTCAGACCATGGCTTCCATCACCGACTTTCATTACCCCCAGCCTCCCTCACAAGCTGAAGCACGCAAGGCCG
CTGTCGAGGCCAAACTGAGGAAACTCGGCAACGCACTGGGATACATGAAGCGCGTCGAGATCGAGATTCAGGCCC
AGAAGATCCAAAGCATCGTCACCAACCTTCTCACCACCCTGAACTTCGCCCTGCCCGACTTGTGCGACTGTCCCA
GCCAGGTGAAAGAGATCCAGCTGCTCACGGCCCTTCGCGACTCGCGTGATAAGCTCGAGGCAGCGCTTCTCTGCG
CCACGTCCCGAGGCTACCATGACGTCGTTGACTATATTCTTCAAAAGGCTCTCTACACCACCGACATCAACGCCG
TAGACGAAGACGGCAACTCGGCCCTACTACTGGCCGTCGCCAACGGTCGTACTGACATGGCCGCCAGGTTGCTGC
ACGCCGGAGCTGACCCAAACCTGGCCAACAAGCACGGTCAAACCCTGGCGTCTCTGGGCGCCGACTCTGAGCAGA
ATGGGGTGGCGACGCCCGAGACAAAAAGGGCAAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail