Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3099
Gene name
Locationscaffold_247:3971..5072
Strand+
Gene length (bp)1101
Transcript length (bp)1101
Coding sequence length (bp)1098
Protein length (aa) 366

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04488 Gly_transf_sug Glycosyltransferase sugar-binding region containing DXD motif 1.0E-08 132 202

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus Signal peptide|Transmembrane domain 0.1685 0.1631 0.2936 0.2226 0.108 0.0166 0.5598 0.1253 0.7589 0.0115

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 20.15 8.54 31.76
CcL In ants, during behavior modification 16.16 6.40 25.92
CcD In ants, recently dead 7.86 2.29 13.43

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.485451 no
SC16a CcD 0.003199 yes
CcL CcD 0.026101 yes

Orthologs

Orthofinder run ID4
Orthogroup201
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7636
Ophiocordyceps australis map64 (Brazil) OphauB2|2476
Ophiocordyceps australis map64 (Brazil) OphauB2|3326
Ophiocordyceps camponoti-floridani Ophcf2|01608
Ophiocordyceps camponoti-floridani Ophcf2|02341
Ophiocordyceps camponoti-rufipedis Ophun1|1578
Ophiocordyceps camponoti-rufipedis Ophun1|1921
Ophiocordyceps kimflemingae Ophio5|1705
Ophiocordyceps kimflemingae Ophio5|3099 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10364
Ophiocordyceps subramaniannii Hirsu2|7127

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3099
MGPLLRICLMMSIALSLWHVFPGFLRLGDYVSQNNRFSGQRAVEQDFTPTSKELACLHGLPLSSETEETAEEWPI
PNIVNFIFFQKVPASGPEGDFGFLNYLAVRSAIISLKPERVYIHYGFPAASPAWISVVSDATDVESAITNNPWIR
RLRPHVELKRYNKPLDSLLRHKEHLADRIRLEILLENGGIYMDTDAYALRPFGKALTPPSPHDAVLGYEGGNRGG
MCNAVIAARSNSSFIRRWLDTYENADLNHEWNYHSVIIPKQLAVNHPNEICELPPDAFFWPTWTWGDVRWMHEPL
SKSEANYWRGRIQELGGSLFPNQLVYHAWSQMSRQRYLKRLTPNIIRREDTRFNLLVRRFLEDDND
Coding >Ophio5|3099
ATGGGTCCTTTGCTTCGCATCTGCCTCATGATGAGCATTGCTCTCTCCCTTTGGCACGTCTTTCCGGGATTCTTG
CGACTCGGTGACTACGTCTCACAGAACAATCGGTTTTCTGGCCAAAGAGCTGTCGAGCAAGACTTTACACCTACC
AGCAAGGAACTCGCCTGCCTTCATGGCCTGCCCCTTTCTTCCGAGACGGAAGAGACGGCCGAGGAGTGGCCGATA
CCCAACATTGTCAACTTCATCTTCTTCCAAAAGGTTCCCGCCAGCGGACCTGAGGGAGACTTTGGCTTTCTCAAC
TACCTCGCCGTCCGCAGCGCTATAATCTCCCTGAAACCCGAACGGGTTTACATTCATTACGGCTTTCCGGCTGCG
TCGCCCGCATGGATCAGCGTGGTCAGTGATGCGACGGACGTCGAAAGCGCCATCACCAACAATCCCTGGATCCGT
CGGCTGAGGCCTCATGTCGAACTCAAGCGGTATAACAAGCCTCTTGATTCCCTCCTTAGGCACAAAGAGCACTTG
GCCGATCGAATTCGGCTCGAAATCTTACTCGAAAATGGAGGCATCTATATGGATACAGATGCCTACGCGCTTCGA
CCGTTTGGAAAAGCTCTCACGCCCCCTTCGCCGCACGATGCTGTTCTCGGATACGAAGGCGGTAATCGTGGCGGC
ATGTGCAACGCCGTAATTGCTGCTCGATCCAACAGCTCCTTTATCCGTCGCTGGCTGGACACGTACGAGAATGCC
GATCTCAACCACGAGTGGAATTACCACAGTGTCATTATTCCGAAGCAGCTCGCCGTCAATCACCCAAACGAGATT
TGCGAGCTGCCTCCAGATGCCTTCTTCTGGCCTACCTGGACCTGGGGGGATGTACGATGGATGCATGAGCCTCTG
AGTAAGAGCGAAGCCAACTACTGGAGAGGACGCATACAGGAGCTGGGCGGCAGCTTGTTCCCCAATCAGCTCGTC
TATCATGCCTGGAGCCAGATGAGCAGGCAGCGATACCTGAAGCGCCTCACACCCAACATCATACGCAGGGAGGAC
ACCAGGTTTAACCTCCTCGTGCGACGCTTCTTGGAGGACGACAACGAT
Transcript >Ophio5|3099
ATGGGTCCTTTGCTTCGCATCTGCCTCATGATGAGCATTGCTCTCTCCCTTTGGCACGTCTTTCCGGGATTCTTG
CGACTCGGTGACTACGTCTCACAGAACAATCGGTTTTCTGGCCAAAGAGCTGTCGAGCAAGACTTTACACCTACC
AGCAAGGAACTCGCCTGCCTTCATGGCCTGCCCCTTTCTTCCGAGACGGAAGAGACGGCCGAGGAGTGGCCGATA
CCCAACATTGTCAACTTCATCTTCTTCCAAAAGGTTCCCGCCAGCGGACCTGAGGGAGACTTTGGCTTTCTCAAC
TACCTCGCCGTCCGCAGCGCTATAATCTCCCTGAAACCCGAACGGGTTTACATTCATTACGGCTTTCCGGCTGCG
TCGCCCGCATGGATCAGCGTGGTCAGTGATGCGACGGACGTCGAAAGCGCCATCACCAACAATCCCTGGATCCGT
CGGCTGAGGCCTCATGTCGAACTCAAGCGGTATAACAAGCCTCTTGATTCCCTCCTTAGGCACAAAGAGCACTTG
GCCGATCGAATTCGGCTCGAAATCTTACTCGAAAATGGAGGCATCTATATGGATACAGATGCCTACGCGCTTCGA
CCGTTTGGAAAAGCTCTCACGCCCCCTTCGCCGCACGATGCTGTTCTCGGATACGAAGGCGGTAATCGTGGCGGC
ATGTGCAACGCCGTAATTGCTGCTCGATCCAACAGCTCCTTTATCCGTCGCTGGCTGGACACGTACGAGAATGCC
GATCTCAACCACGAGTGGAATTACCACAGTGTCATTATTCCGAAGCAGCTCGCCGTCAATCACCCAAACGAGATT
TGCGAGCTGCCTCCAGATGCCTTCTTCTGGCCTACCTGGACCTGGGGGGATGTACGATGGATGCATGAGCCTCTG
AGTAAGAGCGAAGCCAACTACTGGAGAGGACGCATACAGGAGCTGGGCGGCAGCTTGTTCCCCAATCAGCTCGTC
TATCATGCCTGGAGCCAGATGAGCAGGCAGCGATACCTGAAGCGCCTCACACCCAACATCATACGCAGGGAGGAC
ACCAGGTTTAACCTCCTCGTGCGACGCTTCTTGGAGGACGACAACGATTAA
Gene >Ophio5|3099
ATGGGTCCTTTGCTTCGCATCTGCCTCATGATGAGCATTGCTCTCTCCCTTTGGCACGTCTTTCCGGGATTCTTG
CGACTCGGTGACTACGTCTCACAGAACAATCGGTTTTCTGGCCAAAGAGCTGTCGAGCAAGACTTTACACCTACC
AGCAAGGAACTCGCCTGCCTTCATGGCCTGCCCCTTTCTTCCGAGACGGAAGAGACGGCCGAGGAGTGGCCGATA
CCCAACATTGTCAACTTCATCTTCTTCCAAAAGGTTCCCGCCAGCGGACCTGAGGGAGACTTTGGCTTTCTCAAC
TACCTCGCCGTCCGCAGCGCTATAATCTCCCTGAAACCCGAACGGGTTTACATTCATTACGGCTTTCCGGCTGCG
TCGCCCGCATGGATCAGCGTGGTCAGTGATGCGACGGACGTCGAAAGCGCCATCACCAACAATCCCTGGATCCGT
CGGCTGAGGCCTCATGTCGAACTCAAGCGGTATAACAAGCCTCTTGATTCCCTCCTTAGGCACAAAGAGCACTTG
GCCGATCGAATTCGGCTCGAAATCTTACTCGAAAATGGAGGCATCTATATGGATACAGATGCCTACGCGCTTCGA
CCGTTTGGAAAAGCTCTCACGCCCCCTTCGCCGCACGATGCTGTTCTCGGATACGAAGGCGGTAATCGTGGCGGC
ATGTGCAACGCCGTAATTGCTGCTCGATCCAACAGCTCCTTTATCCGTCGCTGGCTGGACACGTACGAGAATGCC
GATCTCAACCACGAGTGGAATTACCACAGTGTCATTATTCCGAAGCAGCTCGCCGTCAATCACCCAAACGAGATT
TGCGAGCTGCCTCCAGATGCCTTCTTCTGGCCTACCTGGACCTGGGGGGATGTACGATGGATGCATGAGCCTCTG
AGTAAGAGCGAAGCCAACTACTGGAGAGGACGCATACAGGAGCTGGGCGGCAGCTTGTTCCCCAATCAGCTCGTC
TATCATGCCTGGAGCCAGATGAGCAGGCAGCGATACCTGAAGCGCCTCACACCCAACATCATACGCAGGGAGGAC
ACCAGGTTTAACCTCCTCGTGCGACGCTTCTTGGAGGACGACAACGATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail