Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3081
Gene name
Locationscaffold_245:2127..8308
Strand-
Gene length (bp)6181
Transcript length (bp)5880
Coding sequence length (bp)5877
Protein length (aa) 1959

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12110 Nup96 Nuclear protein 96 3.1E-89 1490 1787
PF04096 Nucleoporin2 Nucleoporin autopeptidase 1.2E-47 896 1040
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 1.4E+01 44 141
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 1.4E+00 355 444
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 4.8E-09 401 488
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 6.3E-10 471 560
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 1.9E-06 549 626

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G0SAK3|NU145_CHATD Nucleoporin NUP145 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP145 PE=1 SV=1 5 1913 0.0E+00
sp|Q9UTK4|NU189_SCHPO Nucleoporin nup189 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup189 PE=1 SV=1 43 1049 3.0E-72
sp|Q9UTK4|NU189_SCHPO Nucleoporin nup189 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup189 PE=1 SV=1 1434 1864 2.0E-60
sp|P52948|NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens GN=NUP98 PE=1 SV=4 1432 1918 9.0E-44
sp|P49793|NUP98_RAT Nuclear pore complex protein Nup98-Nup96 OS=Rattus norvegicus GN=Nup98 PE=1 SV=2 1402 1921 2.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G0SAK3|NU145_CHATD Nucleoporin NUP145 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP145 PE=1 SV=1 5 1913 0.0E+00
sp|Q9UTK4|NU189_SCHPO Nucleoporin nup189 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup189 PE=1 SV=1 43 1049 3.0E-72
sp|Q9UTK4|NU189_SCHPO Nucleoporin nup189 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup189 PE=1 SV=1 1434 1864 2.0E-60
sp|P52948|NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens GN=NUP98 PE=1 SV=4 1432 1918 9.0E-44
sp|P49793|NUP98_RAT Nuclear pore complex protein Nup98-Nup96 OS=Rattus norvegicus GN=Nup98 PE=1 SV=2 1402 1921 2.0E-43
sp|Q6PFD9|NUP98_MOUSE Nuclear pore complex protein Nup98-Nup96 OS=Mus musculus GN=Nup98 PE=1 SV=2 1430 1918 4.0E-43
sp|Q02630|NU116_YEAST Nucleoporin NUP116/NSP116 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP116 PE=1 SV=2 114 624 1.0E-34
sp|Q54EQ8|NUP98_DICDI Nuclear pore complex protein Nup98-Nup96 OS=Dictyostelium discoideum GN=nup98 PE=3 SV=1 1458 1928 4.0E-32
sp|Q6PFD9|NUP98_MOUSE Nuclear pore complex protein Nup98-Nup96 OS=Mus musculus GN=Nup98 PE=1 SV=2 131 1056 2.0E-30
sp|P52948|NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens GN=NUP98 PE=1 SV=4 35 517 4.0E-27
sp|P52948|NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens GN=NUP98 PE=1 SV=4 271 1056 8.0E-27
sp|Q6PFD9|NUP98_MOUSE Nuclear pore complex protein Nup98-Nup96 OS=Mus musculus GN=Nup98 PE=1 SV=2 74 477 8.0E-25
sp|P49793|NUP98_RAT Nuclear pore complex protein Nup98-Nup96 OS=Rattus norvegicus GN=Nup98 PE=1 SV=2 35 477 2.0E-24
sp|G5EEH9|NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans GN=npp-10 PE=2 SV=1 73 489 1.0E-23
sp|Q02630|NU116_YEAST Nucleoporin NUP116/NSP116 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP116 PE=1 SV=2 898 1034 1.0E-22
sp|G5EEH9|NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans GN=npp-10 PE=2 SV=1 1438 1884 7.0E-22
sp|P49687|NU145_YEAST Nucleoporin NUP145 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP145 PE=1 SV=1 898 1040 1.0E-19
sp|Q02629|NU100_YEAST Nucleoporin NUP100/NSP100 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP100 PE=1 SV=1 898 1034 1.0E-19
sp|G5EEH9|NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans GN=npp-10 PE=2 SV=1 885 1056 2.0E-19
sp|P49687|NU145_YEAST Nucleoporin NUP145 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP145 PE=1 SV=1 1435 1938 5.0E-19
sp|Q02630|NU116_YEAST Nucleoporin NUP116/NSP116 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP116 PE=1 SV=2 258 585 9.0E-19
sp|F4ID16|NU98B_ARATH Nuclear pore complex protein NUP98B OS=Arabidopsis thaliana GN=NUP98B PE=1 SV=1 898 1045 5.0E-18
sp|Q02630|NU116_YEAST Nucleoporin NUP116/NSP116 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP116 PE=1 SV=2 88 573 7.0E-18
sp|Q8LLD0|NUP96_ARATH Nuclear pore complex protein NUP96 OS=Arabidopsis thaliana GN=NUP96 PE=1 SV=1 1432 1862 1.0E-17
sp|Q54EQ8|NUP98_DICDI Nuclear pore complex protein Nup98-Nup96 OS=Dictyostelium discoideum GN=nup98 PE=3 SV=1 874 1050 2.0E-16
sp|Q8RY25|NU98A_ARATH Nuclear pore complex protein NUP98A OS=Arabidopsis thaliana GN=NUP98A PE=1 SV=1 898 1047 4.0E-16
sp|P49793|NUP98_RAT Nuclear pore complex protein Nup98-Nup96 OS=Rattus norvegicus GN=Nup98 PE=1 SV=2 898 1056 4.0E-15
sp|G5EEH9|NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans GN=npp-10 PE=2 SV=1 292 607 7.0E-15
sp|Q6PFD9|NUP98_MOUSE Nuclear pore complex protein Nup98-Nup96 OS=Mus musculus GN=Nup98 PE=1 SV=2 269 613 4.0E-14
sp|G5EEH9|NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans GN=npp-10 PE=2 SV=1 401 631 1.0E-12
sp|P48837|NUP57_YEAST Nucleoporin NUP57 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP57 PE=1 SV=1 365 616 2.0E-12
sp|Q02199|NUP49_YEAST Nucleoporin NUP49/NSP49 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP49 PE=1 SV=1 281 526 9.0E-12
sp|G0S4X2|NUP49_CHATD Nucleoporin NUP49 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP49 PE=1 SV=1 413 603 2.0E-11
sp|Q02629|NU100_YEAST Nucleoporin NUP100/NSP100 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP100 PE=1 SV=1 257 629 8.0E-11
sp|P52948|NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens GN=NUP98 PE=1 SV=4 304 613 1.0E-10
sp|P49687|NU145_YEAST Nucleoporin NUP145 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP145 PE=1 SV=1 278 526 5.0E-10
sp|P49793|NUP98_RAT Nuclear pore complex protein Nup98-Nup96 OS=Rattus norvegicus GN=Nup98 PE=1 SV=2 147 550 6.0E-10
sp|Q8LLD0|NUP96_ARATH Nuclear pore complex protein NUP96 OS=Arabidopsis thaliana GN=NUP96 PE=1 SV=1 898 1054 6.0E-10
sp|Q02629|NU100_YEAST Nucleoporin NUP100/NSP100 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP100 PE=1 SV=1 89 565 1.0E-09
sp|Q9UTK4|NU189_SCHPO Nucleoporin nup189 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup189 PE=1 SV=1 9 541 2.0E-09
sp|P49793|NUP98_RAT Nuclear pore complex protein Nup98-Nup96 OS=Rattus norvegicus GN=Nup98 PE=1 SV=2 322 613 3.0E-09
sp|Q02629|NU100_YEAST Nucleoporin NUP100/NSP100 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP100 PE=1 SV=1 34 683 7.0E-09
sp|Q02630|NU116_YEAST Nucleoporin NUP116/NSP116 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP116 PE=1 SV=2 237 541 1.0E-08
sp|P49687|NU145_YEAST Nucleoporin NUP145 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP145 PE=1 SV=1 374 637 8.0E-08
sp|G0S4X2|NUP49_CHATD Nucleoporin NUP49 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP49 PE=1 SV=1 356 514 2.0E-07
sp|P49687|NU145_YEAST Nucleoporin NUP145 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP145 PE=1 SV=1 259 474 5.0E-07
sp|Q02630|NU116_YEAST Nucleoporin NUP116/NSP116 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP116 PE=1 SV=2 24 519 1.0E-06
sp|Q02199|NUP49_YEAST Nucleoporin NUP49/NSP49 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP49 PE=1 SV=1 239 429 2.0E-06
sp|G0SDP9|NU152_CHATD Nucleoporin NUP152 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP152 PE=3 SV=1 296 627 2.0E-06
sp|P48837|NUP57_YEAST Nucleoporin NUP57 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP57 PE=1 SV=1 282 441 4.0E-06
sp|P48837|NUP57_YEAST Nucleoporin NUP57 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP57 PE=1 SV=1 339 524 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006913 nucleocytoplasmic transport Yes
GO:0017056 structural constituent of nuclear pore Yes
GO:0005643 nuclear pore Yes
GO:0046907 intracellular transport No
GO:0008150 biological_process No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0032991 protein-containing complex No
GO:0005575 cellular_component No
GO:0140513 nuclear protein-containing complex No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0051641 cellular localization No
GO:0051169 nuclear transport No
GO:0009987 cellular process No
GO:0005198 structural molecule activity No
GO:0051649 establishment of localization in cell No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3081
MSFGSNSFGGFGSNPNQTPSGFGSGFGTNNNNNTNSGFGSNAGGGFGQNTNTGSGVFGGNASASGFGSPSVSGGF
GSNAGSGFGSKPAFGSGNTTTGGGLFGGSNTNTANSNSAFGGFGSTNNANSSPFGGGNTTGGGLFGSNANKTGFG
AAGNTSSSLFGATNTGSGGGFGSSGFGAANNSGAGVGDPPGTAATPFAAFVEKEPNSTNQSNSFQNILFQDPYRK
WSAEELRLADYVQGRRHGNASGAGAFGVSSGFGGGFGSNNQTTSAFGTTSNTSGGLFGASNANNTSGGFGQPAAT
GAFGANSGNASGGLFANNNKPSGGLFGNTANQQSGGLFGSGTGGGFGANNSNNNAFGGNTNTGGGLFGSNNQANK
PQGTGFSFGNTNANNNASAFGSNTGGAFGTANTGNSGLFGGSNNQPAGGGLFGNAQQQQQQPNTNSPFGSAFGAQ
NQNQNQQSLFGNALQKPASGGLFGSAATNNTPSGGLFGNANNQQQGTSAFGTNNNTSTTGGLFGAPKPSTTTSLF
GAANTNQANATGTGLFGGLGSNNQTQAASGSSLFGSTNNAQQKSGGLFGTPNQVSGSSLFGGGNSQIQGGSLFGN
SANQQQTQAPGFGGSLLGSTQQVGNAPQGLTANLNDVSAYGSPSLFAGLSGGEVSNPGPLATPLNNSSKPRRSSI
LPMYKLAPSAASRFATPQKRGFGFSYSSFGTPGASPSGSISSTPGALGRSLLGPGSNGTLNKSMSTNNLRRSFNA
EDSILAPGAFSSSSNSRWYGSTGSKKLVINRDIRSDLFSTPQRDKQLADGSASARKLSKRVSFDTSNVEAENGTP
LRNALPAPEDTPTSQSDGSTPRQKRSSAGANGTKTPEMEQVKGNELAVVHEEDHVATPESPDTPGRDRAPGAYWT
EPAREELISMNRMQRQRIAGFTVGRANVGSIAFKVPVDISGIDIDQLCGSVVVLEPRSATVYPNQAKKPPVGRAL
NVPATIVLEQSWPRGGRDRRTSSDFKRFSRHVERLREIPDTTFESFDEDTGTWTFSVEHFTTYGLNDDSDYDSDE
GDSPPKPEMAVPAAHSQIVSSEPPINPPTGDESFGSFHSKGLPGAFDGQEGSPDGKDVAGKQPFLGDSSADLASN
SVQLSVDEYNSNMDDGYDVSEDEEMARSSVGQHRAAEQDDSSSENDQEPKRGTPGGILRARMRAMKDSIGPVRLE
VPDGDDWMSMLMKTVSPAKRDRQQLREQNESPSKRQRVGNLISLDDDGGHLGKSSIWGRSPSKADQASAAKIQLA
MDQGQGFATSIDLMNSLFEKSRFAKTPVASVPTKGLPEWPYERQEKGLAAGEAEQAFHNASRPTWGPGETLVMTR
SLATAQSFRNGSSILAFQSSGIQTQQQDVRLAKFSTVSSQIFLQAQDGLTEIRVVDGIPMATLRAASLRDLFHRQ
DTQNPAIVHEYHVWELASILFDRLDPSDLADGEDLARRSKLSQFWTDMVEPASTTNIGLASCSEERAVACVAGHR
ISDACKFLLEGKNFHLGTLVPLIGTSDEAKKEMRGQLKAWHDSKMLSEFSAATRTIYELLGGNACVCEGMKGVPV
EDRLDSFVISKKFGLDWRQSFGLRLWYAINERDGVAAAVRMFEEDISQDKENLPQPWFIDEGILPLWNDPDATRR
QDLLWGLLRLYADEHDDLEAVLRPENSQLSPLDMRLSWQLGVALTSTGKVSFGQKGLEKADASTLAYATQLTAAG
EWLEAVFVLLHLQDASARARAIQEHLCRHAGLIGPETGTTFSVLVDKFRIPTTWLWEAQALYMRSVAHDASAEVH
CLLRAGSFAEAHRVLVQQVAPRAIIERDYAALSAVVCPIEERRDSIPGWALGGQVYSSFLTLLQHRERCESVSPA
LLEKLLSGLGAMSDSVGEVEGEIERFAAVADMADETAREILKLSKTKQDMELRSRILGLPLTQDRLLAYSVDLGI
DCYREVMSH
Coding >Ophio5|3081
ATGTCGTTTGGTAGCAACAGCTTCGGGGGCTTCGGCTCAAACCCCAACCAGACGCCGAGCGGCTTTGGAAGCGGC
TTCGGCACAAATAACAACAACAATACCAATTCAGGCTTCGGCTCCAACGCTGGCGGCGGTTTTGGCCAGAATACG
AACACAGGAAGCGGCGTGTTTGGTGGCAACGCCAGTGCCTCCGGCTTTGGCTCTCCTTCGGTCTCAGGAGGCTTC
GGGTCAAACGCTGGCAGTGGCTTTGGAAGCAAGCCTGCCTTTGGTTCTGGCAACACAACAACCGGCGGTGGCTTG
TTTGGGGGTTCCAATACCAACACTGCCAACAGCAACTCCGCCTTTGGTGGCTTCGGCAGTACAAACAATGCCAAC
TCATCCCCCTTTGGAGGCGGAAACACCACCGGCGGAGGCCTCTTCGGGAGTAACGCCAACAAGACCGGCTTTGGT
GCCGCAGGTAATACCAGTTCGTCGCTCTTCGGCGCTACAAACACCGGCTCCGGTGGCGGTTTCGGCAGTAGTGGG
TTTGGCGCCGCGAACAATTCCGGGGCTGGAGTCGGAGATCCACCTGGCACCGCTGCGACACCCTTCGCAGCCTTT
GTCGAAAAGGAGCCCAACAGTACGAATCAGTCAAACTCGTTCCAGAATATCCTCTTCCAGGACCCCTATCGGAAA
TGGTCCGCTGAAGAATTGCGACTGGCAGACTACGTCCAGGGACGCCGCCACGGCAATGCAAGCGGAGCCGGCGCG
TTCGGTGTGAGCTCTGGCTTCGGGGGTGGCTTTGGTTCCAACAACCAGACCACGAGTGCATTTGGAACGACTTCG
AACACCAGCGGCGGACTCTTCGGGGCCAGCAACGCCAATAACACTTCGGGTGGATTCGGGCAGCCTGCTGCTACT
GGAGCATTCGGAGCCAACAGTGGCAACGCGTCAGGCGGCCTGTTTGCCAATAATAATAAGCCCAGTGGTGGTCTT
TTTGGCAATACTGCGAATCAGCAGAGCGGCGGCCTCTTTGGCTCAGGAACTGGTGGAGGGTTCGGCGCGAACAAT
AGCAACAACAACGCCTTTGGCGGCAACACTAACACTGGAGGCGGTCTCTTCGGCTCCAACAACCAGGCCAACAAG
CCCCAGGGAACTGGCTTCAGCTTCGGAAACACCAATGCCAATAACAACGCGTCTGCGTTCGGGTCCAACACTGGA
GGTGCTTTTGGCACGGCGAACACAGGAAACTCGGGTCTCTTCGGGGGCTCCAACAATCAGCCGGCCGGCGGCGGC
CTCTTTGGCAATGCCCAGCAGCAGCAGCAGCAGCCGAACACTAATTCTCCTTTTGGGTCCGCTTTCGGCGCGCAG
AACCAGAACCAGAATCAGCAGAGTCTTTTTGGCAATGCCCTGCAGAAACCAGCCTCGGGCGGCCTCTTCGGCTCG
GCCGCTACCAACAACACGCCGTCTGGCGGCCTCTTCGGGAACGCCAATAACCAGCAACAAGGCACTAGCGCTTTC
GGCACAAACAACAACACATCGACCACGGGCGGTCTTTTCGGCGCCCCCAAGCCCAGCACTACCACCAGTCTCTTC
GGCGCAGCCAATACGAACCAGGCCAATGCCACCGGCACTGGTCTGTTTGGAGGGCTGGGGTCCAACAATCAGACT
CAAGCAGCTTCCGGCTCCTCTTTGTTCGGTTCGACGAACAATGCTCAGCAGAAATCCGGCGGTCTCTTCGGCACA
CCTAACCAAGTGTCGGGCTCGAGCCTTTTCGGGGGAGGGAACAGCCAGATTCAGGGCGGCTCGCTTTTTGGCAAT
AGTGCAAACCAGCAGCAGACCCAGGCCCCAGGCTTCGGCGGTTCCCTGCTGGGTAGCACCCAACAAGTCGGCAAC
GCTCCTCAGGGACTCACGGCCAACCTCAACGACGTCTCAGCCTACGGCAGTCCCTCTCTATTTGCTGGCCTGAGC
GGCGGCGAGGTCTCCAACCCTGGTCCTCTCGCCACGCCGCTGAACAACAGCTCGAAGCCACGGCGAAGCTCCATC
CTTCCCATGTACAAGCTTGCTCCGTCGGCCGCGTCGCGATTTGCCACTCCCCAGAAGCGAGGCTTCGGCTTCTCC
TACAGCTCGTTCGGGACACCTGGAGCGAGCCCCTCCGGCAGCATCTCGAGCACGCCTGGCGCTCTGGGCCGCAGC
CTGCTCGGCCCCGGCTCGAACGGCACGCTTAATAAGAGCATGTCGACGAACAACCTTCGCCGCAGCTTCAACGCC
GAGGACAGCATACTGGCACCGGGTGCTTTCTCATCCAGCTCTAACAGCCGTTGGTACGGGAGCACAGGGTCGAAG
AAGCTTGTCATAAACAGGGACATCAGGAGCGATCTGTTTTCCACTCCCCAGAGAGACAAGCAATTGGCCGACGGC
AGCGCCAGCGCCCGCAAGCTCTCCAAGCGTGTCAGCTTCGACACCAGCAACGTTGAGGCCGAGAACGGGACGCCG
CTGCGCAACGCGCTTCCCGCTCCGGAGGACACGCCAACCTCCCAGTCAGACGGCTCGACTCCTCGCCAGAAGAGG
AGCTCGGCTGGCGCCAACGGCACCAAAACTCCGGAGATGGAACAGGTCAAGGGCAACGAGTTGGCGGTCGTCCAC
GAGGAGGATCACGTCGCCACTCCCGAGTCGCCGGACACGCCCGGCCGCGATCGAGCTCCCGGGGCCTACTGGACA
GAGCCAGCCAGGGAAGAGTTGATCAGCATGAACAGGATGCAGCGGCAAAGGATCGCCGGCTTCACAGTCGGCCGC
GCAAACGTCGGTTCCATCGCGTTCAAGGTGCCCGTGGACATCAGCGGCATCGACATTGACCAGCTCTGCGGCTCC
GTCGTGGTGCTTGAGCCTCGGTCCGCGACTGTGTACCCCAATCAAGCCAAGAAGCCGCCAGTCGGCCGGGCGCTC
AATGTGCCGGCCACAATCGTGCTGGAACAGTCCTGGCCGCGCGGAGGGCGCGATAGGCGCACGTCGAGTGATTTC
AAACGATTTAGCAGGCATGTCGAGCGACTTCGCGAGATCCCCGACACCACTTTTGAGAGTTTCGACGAGGACACT
GGCACGTGGACGTTCTCTGTGGAACACTTCACGACTTACGGTCTGAACGATGACTCGGACTATGATTCGGACGAG
GGGGACAGCCCACCAAAGCCGGAGATGGCGGTGCCCGCGGCCCACTCTCAGATCGTGTCTTCGGAGCCGCCGATC
AATCCGCCTACGGGAGACGAATCTTTCGGTTCATTTCACAGCAAGGGTCTCCCGGGTGCCTTTGATGGGCAAGAG
GGGTCTCCCGACGGAAAAGATGTCGCCGGAAAGCAGCCTTTTTTAGGGGATAGCTCCGCGGATCTGGCGTCCAAC
AGTGTGCAGTTGTCTGTCGACGAGTACAACAGCAACATGGACGACGGATATGACGTGTCCGAAGACGAAGAAATG
GCGAGGTCTTCTGTCGGACAGCATCGTGCCGCGGAGCAGGACGATTCCTCGTCGGAGAATGACCAGGAGCCCAAG
AGAGGCACGCCTGGAGGCATTCTCAGAGCCAGGATGCGAGCCATGAAAGACTCCATCGGTCCAGTGCGGCTCGAA
GTTCCCGATGGCGACGACTGGATGAGTATGCTCATGAAGACGGTCAGCCCCGCCAAGCGCGACCGGCAGCAGCTC
CGTGAGCAAAATGAGTCGCCATCAAAGCGCCAGCGCGTCGGTAATCTCATCAGCCTCGACGACGACGGTGGACAC
CTTGGAAAGTCGTCGATATGGGGCCGAAGCCCGAGCAAGGCGGATCAGGCGTCGGCTGCAAAGATTCAGCTTGCA
ATGGACCAGGGTCAAGGATTTGCCACCAGCATCGACTTGATGAACTCGTTGTTTGAGAAATCAAGGTTCGCGAAG
ACTCCCGTCGCTTCAGTGCCAACGAAAGGGCTTCCAGAGTGGCCCTACGAGCGCCAAGAGAAGGGTTTGGCCGCC
GGCGAAGCCGAGCAAGCGTTCCACAATGCCTCGCGTCCAACGTGGGGACCCGGAGAAACGTTGGTGATGACGCGA
TCGCTGGCGACTGCACAATCGTTTCGCAACGGTTCGAGTATTCTGGCTTTTCAGTCATCAGGCATTCAGACGCAG
CAGCAGGATGTCAGGCTCGCCAAATTTTCCACCGTGTCTTCGCAGATCTTTCTGCAAGCCCAGGACGGGCTGACG
GAAATCCGCGTGGTCGACGGCATTCCCATGGCTACGCTGCGTGCGGCGAGCTTGCGGGATCTCTTTCACCGCCAG
GATACGCAGAACCCTGCCATCGTGCACGAGTATCACGTCTGGGAGCTGGCGAGTATCCTTTTTGACCGACTTGAC
CCTTCGGACCTGGCCGACGGTGAAGACTTGGCGAGGAGGTCGAAGCTATCTCAGTTCTGGACCGACATGGTGGAG
CCGGCGTCGACGACGAATATCGGTCTCGCGAGCTGCAGCGAAGAACGCGCCGTGGCGTGTGTGGCGGGACATCGG
ATCTCGGACGCCTGCAAGTTCCTGCTGGAAGGCAAAAACTTTCATCTCGGCACTCTCGTGCCGCTCATAGGCACC
AGCGACGAGGCCAAAAAGGAGATGAGAGGGCAACTCAAGGCCTGGCACGATTCCAAGATGCTGTCCGAGTTCTCG
GCCGCGACGCGGACCATTTACGAGCTCTTGGGCGGCAACGCCTGTGTCTGCGAAGGGATGAAGGGAGTGCCTGTC
GAGGATCGCTTGGACTCGTTCGTCATCTCCAAAAAGTTTGGACTCGACTGGCGGCAGTCATTCGGCCTTCGGCTG
TGGTACGCCATCAACGAGCGGGATGGTGTGGCGGCGGCAGTCAGAATGTTCGAGGAGGACATAAGCCAAGACAAG
GAGAATTTGCCGCAGCCGTGGTTCATTGACGAGGGCATCTTACCGCTATGGAACGATCCGGACGCGACGCGACGG
CAGGATCTTCTCTGGGGGCTGTTGCGGCTTTACGCGGACGAGCACGACGACCTTGAAGCCGTGCTTCGCCCGGAG
AATTCGCAGCTGTCTCCTCTCGACATGCGACTCAGTTGGCAGTTGGGCGTGGCCTTGACCTCGACCGGCAAGGTT
TCGTTTGGGCAAAAGGGCTTGGAGAAGGCAGACGCTTCGACGCTGGCTTACGCCACGCAGTTGACGGCCGCCGGC
GAGTGGCTCGAGGCCGTCTTCGTTCTGCTGCACTTGCAAGACGCCAGTGCACGAGCCAGGGCGATACAGGAGCAT
CTCTGTCGACATGCGGGCTTGATCGGCCCTGAGACCGGGACGACGTTTTCGGTCCTGGTCGACAAGTTTCGCATC
CCCACGACCTGGCTGTGGGAGGCGCAAGCTCTGTACATGCGCAGCGTTGCCCACGATGCATCAGCCGAGGTGCAC
TGCCTGCTCCGAGCCGGGTCGTTTGCAGAAGCGCACCGGGTTTTGGTGCAGCAAGTGGCGCCGCGGGCCATTATC
GAGCGCGACTATGCAGCGCTGTCGGCTGTCGTGTGCCCAATCGAAGAGCGGCGGGACTCGATTCCCGGATGGGCC
TTGGGCGGCCAGGTCTACAGCAGCTTCCTCACCCTTCTGCAGCATCGCGAGCGGTGCGAGAGCGTTTCGCCGGCG
CTGCTGGAGAAGCTCTTGAGCGGCCTCGGGGCCATGAGTGACAGCGTGGGCGAGGTCGAAGGCGAGATTGAGCGA
TTCGCCGCCGTTGCCGACATGGCGGACGAGACGGCACGAGAGATTTTGAAGTTGAGCAAGACGAAGCAGGACATG
GAGCTACGGTCTCGGATACTCGGGCTGCCTCTGACGCAGGATCGGCTGTTGGCCTACTCGGTGGACCTCGGCATA
GATTGCTACCGTGAGGTGATGTCGCAC
Transcript >Ophio5|3081
ATGTCGTTTGGTAGCAACAGCTTCGGGGGCTTCGGCTCAAACCCCAACCAGACGCCGAGCGGCTTTGGAAGCGGC
TTCGGCACAAATAACAACAACAATACCAATTCAGGCTTCGGCTCCAACGCTGGCGGCGGTTTTGGCCAGAATACG
AACACAGGAAGCGGCGTGTTTGGTGGCAACGCCAGTGCCTCCGGCTTTGGCTCTCCTTCGGTCTCAGGAGGCTTC
GGGTCAAACGCTGGCAGTGGCTTTGGAAGCAAGCCTGCCTTTGGTTCTGGCAACACAACAACCGGCGGTGGCTTG
TTTGGGGGTTCCAATACCAACACTGCCAACAGCAACTCCGCCTTTGGTGGCTTCGGCAGTACAAACAATGCCAAC
TCATCCCCCTTTGGAGGCGGAAACACCACCGGCGGAGGCCTCTTCGGGAGTAACGCCAACAAGACCGGCTTTGGT
GCCGCAGGTAATACCAGTTCGTCGCTCTTCGGCGCTACAAACACCGGCTCCGGTGGCGGTTTCGGCAGTAGTGGG
TTTGGCGCCGCGAACAATTCCGGGGCTGGAGTCGGAGATCCACCTGGCACCGCTGCGACACCCTTCGCAGCCTTT
GTCGAAAAGGAGCCCAACAGTACGAATCAGTCAAACTCGTTCCAGAATATCCTCTTCCAGGACCCCTATCGGAAA
TGGTCCGCTGAAGAATTGCGACTGGCAGACTACGTCCAGGGACGCCGCCACGGCAATGCAAGCGGAGCCGGCGCG
TTCGGTGTGAGCTCTGGCTTCGGGGGTGGCTTTGGTTCCAACAACCAGACCACGAGTGCATTTGGAACGACTTCG
AACACCAGCGGCGGACTCTTCGGGGCCAGCAACGCCAATAACACTTCGGGTGGATTCGGGCAGCCTGCTGCTACT
GGAGCATTCGGAGCCAACAGTGGCAACGCGTCAGGCGGCCTGTTTGCCAATAATAATAAGCCCAGTGGTGGTCTT
TTTGGCAATACTGCGAATCAGCAGAGCGGCGGCCTCTTTGGCTCAGGAACTGGTGGAGGGTTCGGCGCGAACAAT
AGCAACAACAACGCCTTTGGCGGCAACACTAACACTGGAGGCGGTCTCTTCGGCTCCAACAACCAGGCCAACAAG
CCCCAGGGAACTGGCTTCAGCTTCGGAAACACCAATGCCAATAACAACGCGTCTGCGTTCGGGTCCAACACTGGA
GGTGCTTTTGGCACGGCGAACACAGGAAACTCGGGTCTCTTCGGGGGCTCCAACAATCAGCCGGCCGGCGGCGGC
CTCTTTGGCAATGCCCAGCAGCAGCAGCAGCAGCCGAACACTAATTCTCCTTTTGGGTCCGCTTTCGGCGCGCAG
AACCAGAACCAGAATCAGCAGAGTCTTTTTGGCAATGCCCTGCAGAAACCAGCCTCGGGCGGCCTCTTCGGCTCG
GCCGCTACCAACAACACGCCGTCTGGCGGCCTCTTCGGGAACGCCAATAACCAGCAACAAGGCACTAGCGCTTTC
GGCACAAACAACAACACATCGACCACGGGCGGTCTTTTCGGCGCCCCCAAGCCCAGCACTACCACCAGTCTCTTC
GGCGCAGCCAATACGAACCAGGCCAATGCCACCGGCACTGGTCTGTTTGGAGGGCTGGGGTCCAACAATCAGACT
CAAGCAGCTTCCGGCTCCTCTTTGTTCGGTTCGACGAACAATGCTCAGCAGAAATCCGGCGGTCTCTTCGGCACA
CCTAACCAAGTGTCGGGCTCGAGCCTTTTCGGGGGAGGGAACAGCCAGATTCAGGGCGGCTCGCTTTTTGGCAAT
AGTGCAAACCAGCAGCAGACCCAGGCCCCAGGCTTCGGCGGTTCCCTGCTGGGTAGCACCCAACAAGTCGGCAAC
GCTCCTCAGGGACTCACGGCCAACCTCAACGACGTCTCAGCCTACGGCAGTCCCTCTCTATTTGCTGGCCTGAGC
GGCGGCGAGGTCTCCAACCCTGGTCCTCTCGCCACGCCGCTGAACAACAGCTCGAAGCCACGGCGAAGCTCCATC
CTTCCCATGTACAAGCTTGCTCCGTCGGCCGCGTCGCGATTTGCCACTCCCCAGAAGCGAGGCTTCGGCTTCTCC
TACAGCTCGTTCGGGACACCTGGAGCGAGCCCCTCCGGCAGCATCTCGAGCACGCCTGGCGCTCTGGGCCGCAGC
CTGCTCGGCCCCGGCTCGAACGGCACGCTTAATAAGAGCATGTCGACGAACAACCTTCGCCGCAGCTTCAACGCC
GAGGACAGCATACTGGCACCGGGTGCTTTCTCATCCAGCTCTAACAGCCGTTGGTACGGGAGCACAGGGTCGAAG
AAGCTTGTCATAAACAGGGACATCAGGAGCGATCTGTTTTCCACTCCCCAGAGAGACAAGCAATTGGCCGACGGC
AGCGCCAGCGCCCGCAAGCTCTCCAAGCGTGTCAGCTTCGACACCAGCAACGTTGAGGCCGAGAACGGGACGCCG
CTGCGCAACGCGCTTCCCGCTCCGGAGGACACGCCAACCTCCCAGTCAGACGGCTCGACTCCTCGCCAGAAGAGG
AGCTCGGCTGGCGCCAACGGCACCAAAACTCCGGAGATGGAACAGGTCAAGGGCAACGAGTTGGCGGTCGTCCAC
GAGGAGGATCACGTCGCCACTCCCGAGTCGCCGGACACGCCCGGCCGCGATCGAGCTCCCGGGGCCTACTGGACA
GAGCCAGCCAGGGAAGAGTTGATCAGCATGAACAGGATGCAGCGGCAAAGGATCGCCGGCTTCACAGTCGGCCGC
GCAAACGTCGGTTCCATCGCGTTCAAGGTGCCCGTGGACATCAGCGGCATCGACATTGACCAGCTCTGCGGCTCC
GTCGTGGTGCTTGAGCCTCGGTCCGCGACTGTGTACCCCAATCAAGCCAAGAAGCCGCCAGTCGGCCGGGCGCTC
AATGTGCCGGCCACAATCGTGCTGGAACAGTCCTGGCCGCGCGGAGGGCGCGATAGGCGCACGTCGAGTGATTTC
AAACGATTTAGCAGGCATGTCGAGCGACTTCGCGAGATCCCCGACACCACTTTTGAGAGTTTCGACGAGGACACT
GGCACGTGGACGTTCTCTGTGGAACACTTCACGACTTACGGTCTGAACGATGACTCGGACTATGATTCGGACGAG
GGGGACAGCCCACCAAAGCCGGAGATGGCGGTGCCCGCGGCCCACTCTCAGATCGTGTCTTCGGAGCCGCCGATC
AATCCGCCTACGGGAGACGAATCTTTCGGTTCATTTCACAGCAAGGGTCTCCCGGGTGCCTTTGATGGGCAAGAG
GGGTCTCCCGACGGAAAAGATGTCGCCGGAAAGCAGCCTTTTTTAGGGGATAGCTCCGCGGATCTGGCGTCCAAC
AGTGTGCAGTTGTCTGTCGACGAGTACAACAGCAACATGGACGACGGATATGACGTGTCCGAAGACGAAGAAATG
GCGAGGTCTTCTGTCGGACAGCATCGTGCCGCGGAGCAGGACGATTCCTCGTCGGAGAATGACCAGGAGCCCAAG
AGAGGCACGCCTGGAGGCATTCTCAGAGCCAGGATGCGAGCCATGAAAGACTCCATCGGTCCAGTGCGGCTCGAA
GTTCCCGATGGCGACGACTGGATGAGTATGCTCATGAAGACGGTCAGCCCCGCCAAGCGCGACCGGCAGCAGCTC
CGTGAGCAAAATGAGTCGCCATCAAAGCGCCAGCGCGTCGGTAATCTCATCAGCCTCGACGACGACGGTGGACAC
CTTGGAAAGTCGTCGATATGGGGCCGAAGCCCGAGCAAGGCGGATCAGGCGTCGGCTGCAAAGATTCAGCTTGCA
ATGGACCAGGGTCAAGGATTTGCCACCAGCATCGACTTGATGAACTCGTTGTTTGAGAAATCAAGGTTCGCGAAG
ACTCCCGTCGCTTCAGTGCCAACGAAAGGGCTTCCAGAGTGGCCCTACGAGCGCCAAGAGAAGGGTTTGGCCGCC
GGCGAAGCCGAGCAAGCGTTCCACAATGCCTCGCGTCCAACGTGGGGACCCGGAGAAACGTTGGTGATGACGCGA
TCGCTGGCGACTGCACAATCGTTTCGCAACGGTTCGAGTATTCTGGCTTTTCAGTCATCAGGCATTCAGACGCAG
CAGCAGGATGTCAGGCTCGCCAAATTTTCCACCGTGTCTTCGCAGATCTTTCTGCAAGCCCAGGACGGGCTGACG
GAAATCCGCGTGGTCGACGGCATTCCCATGGCTACGCTGCGTGCGGCGAGCTTGCGGGATCTCTTTCACCGCCAG
GATACGCAGAACCCTGCCATCGTGCACGAGTATCACGTCTGGGAGCTGGCGAGTATCCTTTTTGACCGACTTGAC
CCTTCGGACCTGGCCGACGGTGAAGACTTGGCGAGGAGGTCGAAGCTATCTCAGTTCTGGACCGACATGGTGGAG
CCGGCGTCGACGACGAATATCGGTCTCGCGAGCTGCAGCGAAGAACGCGCCGTGGCGTGTGTGGCGGGACATCGG
ATCTCGGACGCCTGCAAGTTCCTGCTGGAAGGCAAAAACTTTCATCTCGGCACTCTCGTGCCGCTCATAGGCACC
AGCGACGAGGCCAAAAAGGAGATGAGAGGGCAACTCAAGGCCTGGCACGATTCCAAGATGCTGTCCGAGTTCTCG
GCCGCGACGCGGACCATTTACGAGCTCTTGGGCGGCAACGCCTGTGTCTGCGAAGGGATGAAGGGAGTGCCTGTC
GAGGATCGCTTGGACTCGTTCGTCATCTCCAAAAAGTTTGGACTCGACTGGCGGCAGTCATTCGGCCTTCGGCTG
TGGTACGCCATCAACGAGCGGGATGGTGTGGCGGCGGCAGTCAGAATGTTCGAGGAGGACATAAGCCAAGACAAG
GAGAATTTGCCGCAGCCGTGGTTCATTGACGAGGGCATCTTACCGCTATGGAACGATCCGGACGCGACGCGACGG
CAGGATCTTCTCTGGGGGCTGTTGCGGCTTTACGCGGACGAGCACGACGACCTTGAAGCCGTGCTTCGCCCGGAG
AATTCGCAGCTGTCTCCTCTCGACATGCGACTCAGTTGGCAGTTGGGCGTGGCCTTGACCTCGACCGGCAAGGTT
TCGTTTGGGCAAAAGGGCTTGGAGAAGGCAGACGCTTCGACGCTGGCTTACGCCACGCAGTTGACGGCCGCCGGC
GAGTGGCTCGAGGCCGTCTTCGTTCTGCTGCACTTGCAAGACGCCAGTGCACGAGCCAGGGCGATACAGGAGCAT
CTCTGTCGACATGCGGGCTTGATCGGCCCTGAGACCGGGACGACGTTTTCGGTCCTGGTCGACAAGTTTCGCATC
CCCACGACCTGGCTGTGGGAGGCGCAAGCTCTGTACATGCGCAGCGTTGCCCACGATGCATCAGCCGAGGTGCAC
TGCCTGCTCCGAGCCGGGTCGTTTGCAGAAGCGCACCGGGTTTTGGTGCAGCAAGTGGCGCCGCGGGCCATTATC
GAGCGCGACTATGCAGCGCTGTCGGCTGTCGTGTGCCCAATCGAAGAGCGGCGGGACTCGATTCCCGGATGGGCC
TTGGGCGGCCAGGTCTACAGCAGCTTCCTCACCCTTCTGCAGCATCGCGAGCGGTGCGAGAGCGTTTCGCCGGCG
CTGCTGGAGAAGCTCTTGAGCGGCCTCGGGGCCATGAGTGACAGCGTGGGCGAGGTCGAAGGCGAGATTGAGCGA
TTCGCCGCCGTTGCCGACATGGCGGACGAGACGGCACGAGAGATTTTGAAGTTGAGCAAGACGAAGCAGGACATG
GAGCTACGGTCTCGGATACTCGGGCTGCCTCTGACGCAGGATCGGCTGTTGGCCTACTCGGTGGACCTCGGCATA
GATTGCTACCGTGAGGTGATGTCGCACTGA
Gene >Ophio5|3081
ATGTCGTTTGGTAGCAACAGCTTCGGGGGCTTCGGCTCAAACCCCAACCAGACGCCGAGCGGCTTTGGAAGCGGC
TTCGGCACAAATAACAACAACAATACCAATTCAGGTACGATGCTCCGGGCAGGAATCATAGTCGCTGTGCTGACC
ACAGCTTCTCTAGGCTTCGGCTCCAACGCTGGCGGCGGTTTTGGCCAGAATACGAACACAGGAAGCGGCGTGTTT
GGTGGCAACGCCAGTGCCTCCGGCTTTGGCTCTCCTTCGGGTAAGGCTTTTCTCATCTCCCTCAACTCTCCTCCA
TCACTACCTCGCTTTTGCATGTCGCTGACGAAGCAGTCTCAGGAGGCTTCGGGTCAAACGCTGGCAGTGGCTTTG
GAAGCAAGCCTGCCTTTGGTTCTGGCAACACAACAACCGGCGGTGGCTTGTTTGGGGGTTCCAATACCAACACTG
CCAACAGCAACTCCGCCTTTGGTGGCTTCGGCAGTACAAACAATGCCAACTCATCCCCCTTTGGAGGCGGAAACA
CCACCGGCGGAGGCCTCTTCGGGAGTAACGCCAACAAGACCGGCTTTGGTGCCGCAGGTAATACCAGTTCGTCGC
TCTTCGGCGCTACAAACACCGGCTCCGGTGGCGGTTTCGGCAGTAGTGGGTTTGGCGCCGCGAACAATTCCGGGG
CTGGAGTCGGAGATCCACCTGGCACCGCTGCGACACCCTTCGCAGCCTTTGTCGAAAAGGAGCCCAACAGTACGA
ATCAGTCAAACTCGTTCCAGAATATCCTCTTCCAGGACCCCTATCGGAAATGGTCCGCTGAAGAATTGCGACTGG
CAGACTACGTCCAGGGACGCCGCCACGGCAATGCAAGCGGAGCCGGCGCGTTCGGTGTGAGCTCTGGCTTCGGGG
GTGGCTTTGGTTCCAACAACCAGACCACGAGTGCATTTGGAACGACTTCGAACACCAGCGGCGGACTCTTCGGGG
CCAGCAACGCCAATAACACTTCGGGTGGATTCGGGCAGCCTGCTGCTACTGGAGCATTCGGAGCCAACAGTGGCA
ACGCGTCAGGCGGCCTGTTTGCCAATAATAATAAGCCCAGTGGTGGTCTTTTTGGCAATACTGCGAATCAGCAGA
GCGGCGGCCTCTTTGGCTCAGGAACTGGTGGAGGGTTCGGCGCGAACAATAGCAACAACAACGCCTTTGGCGGCA
ACACTAACACTGGAGGCGGTCTCTTCGGCTCCAACAACCAGGCCAACAAGCCCCAGGGAACTGGCTTCAGCTTCG
GAAACACCAATGCCAATAACAACGCGTCTGCGTTCGGGTCCAACACTGGAGGTGCTTTTGGCACGGCGAACACAG
GAAACTCGGGTCTCTTCGGGGGCTCCAACAATCAGCCGGCCGGCGGCGGCCTCTTTGGCAATGCCCAGCAGCAGC
AGCAGCAGCCGAACACTAATTCTCCTTTTGGGTCCGCTTTCGGCGCGCAGAACCAGAACCAGAATCAGCAGAGTC
TTTTTGGCAATGCCCTGCAGAAACCAGCCTCGGGCGGCCTCTTCGGCTCGGCCGCTACCAACAACACGCCGTCTG
GCGGCCTCTTCGGGAACGCCAATAACCAGCAACAAGGCACTAGCGCTTTCGGCACAAACAACAACACATCGACCA
CGGGCGGTCTTTTCGGCGCCCCCAAGCCCAGCACTACCACCAGTCTCTTCGGCGCAGCCAATACGAACCAGGCCA
ATGCCACCGGCACTGGTCTGTTTGGAGGGCTGGGGTCCAACAATCAGACTCAAGCAGCTTCCGGCTCCTCTTTGT
TCGGTTCGACGAACAATGCTCAGCAGAAATCCGGCGGTCTCTTCGGCACACCTAACCAAGTGTCGGGCTCGAGCC
TTTTCGGGGGAGGGAACAGCCAGATTCAGGGCGGCTCGCTTTTTGGCAATAGTGCAAACCAGCAGCAGACCCAGG
CCCCAGGCTTCGGCGGTTCCCTGCTGGGTAGCACCCAACAAGTCGGCAACGCTCCTCAGGGACTCACGGCCAACC
TCAACGACGTCTCAGCCTACGGCAGTCCCTCTCTATTTGCTGGCCTGAGCGGCGGCGAGGTCTCCAACCCTGGTC
CTCTCGCCACGCCGCTGAACAACAGCTCGAAGCCACGGCGAAGCTCCATCCTTCCCATGTACAAGCTTGCTCCGT
CGGCCGCGTCGCGATTTGCCACTCCCCAGAAGCGAGGCTTCGGCTTCTCCTACAGCTCGTTCGGGACACCTGGAG
CGAGCCCCTCCGGCAGCATCTCGAGCACGCCTGGCGCTCTGGGCCGCAGCCTGCTCGGCCCCGGCTCGAACGGCA
CGCTTAATAAGAGCATGTCGACGAACAACCTTCGCCGCAGCTTCAACGCCGAGGACAGCATACTGGCACCGGGTG
CTTTCTCATCCAGCTCTAACAGCCGTTGGTACGGGAGCACAGGGTCGAAGAAGCTTGTCATAAACAGGGACATCA
GGAGCGATCTGTTTTCCACTCCCCAGAGAGACAAGCAATTGGCCGACGGCAGCGCCAGCGCCCGCAAGCTCTCCA
AGCGTGTCAGCTTCGACACCAGCAACGTTGAGGCCGAGAACGGGACGCCGCTGCGCAACGCGCTTCCCGCTCCGG
AGGACACGCCAACCTCCCAGTCAGACGGCTCGACTCCTCGCCAGAAGAGGAGCTCGGCTGGCGCCAACGGCACCA
AAACTCCGGAGATGGAACAGGTCAAGGGCAACGAGTTGGCGGTCGTCCACGAGGAGGATCACGTCGCCACTCCCG
AGTCGCCGGACACGCCCGGCCGCGATCGAGCTCCCGGGGCCTACTGGACAGAGCCAGCCAGGGAAGAGTTGATCA
GCATGAACAGGATGCAGCGGCAAAGGATCGCCGGCTTCACAGTCGGCCGCGCAAACGTCGGTTCCATCGCGTTCA
AGGTGCCCGTGGACATCAGCGGCATCGACATTGACCAGCTCTGCGGCTCCGTCGTGGTGCTTGAGCCTCGGTCCG
CGACTGTGTACCCCAATCAAGCCAAGAAGCCGCCAGTCGGCCGGGCGCTCAATGTGCCGGCCACAATCGTGCTGG
AACAGTCCTGGCCGCGCGGAGGGCGCGATAGGCGCACGTCGAGTGATTTCAAACGATTTAGCAGGCATGTCGAGC
GACTTCGCGAGATCCCCGACACCACTTTTGAGAGTTTCGACGAGGACACTGGCACGTGGACGTTCTCTGTGGAAC
ACTTCACGACTTACGGTCTGAACGATGACTCGGACTATGATTCGGACGAGGGGGACAGCCCACCAAAGCCGGAGA
TGGCGGTGCCCGCGGCCCACTCTCAGATCGTGTCTTCGGAGCCGCCGATCAATCCGCCTACGGGAGACGAATCTT
TCGGTTCATTTCACAGCAAGGGTCTCCCGGGTGCCTTTGATGGGCAAGAGGGGTCTCCCGACGGAAAAGATGTCG
CCGGAAAGCAGCCTTTTTTAGGGGATAGCTCCGCGGATCTGGCGTCCAACAGTGTGCAGTTGTCTGTCGACGAGT
ACAACAGCAACATGGACGACGGATATGACGTGTCCGAAGACGAAGAAATGGCGAGGTCTTCTGTCGGACAGCATC
GTGCCGCGGAGCAGGACGATTCCTCGTCGGAGAATGACCAGGAGCCCAAGAGAGGCACGCCTGGAGGCATTCTCA
GAGCCAGGATGCGAGCCATGAAAGACTCCATCGGTCCAGTGCGGCTCGAAGTTCCCGATGGCGACGACTGGATGA
GTATGCTCATGAAGACGGTCAGCCCCGCCAAGCGCGACCGGCAGCAGCTCCGTGAGCAAAATGAGTCGCCATCAA
AGCGCCAGCGCGTCGGTAATCTCATCAGCCTCGACGACGACGGTGGACACCTTGGAAAGTCGTCGATATGGGGCC
GAAGCCCGAGCAAGGCGGATCAGGCGTCGGCTGCAAAGATTCAGCTTGCAATGGACCAGGGTCAAGGATTTGCCA
CCAGCATCGACTTGATGAACTCGTTGTTTGAGAAATCAAGGTTCGCGAAGACTCCCGTCGCTTCAGTGCCAACGA
AAGGGCTTCCAGAGGTATGATCAATTGTTGGCCGATGAGGAGCGTGTCTGATACTGACGTCGTCCACCAGTGGCC
CTACGAGCGCCAAGAGAAGGGTTTGGCCGCCGGCGAAGCCGAGCAAGCGTTCCACAATGCCTCGCGTCCAACGTG
GGGACCCGGAGAAACGTTGGTGATGACGCGATCGCTGGCGACTGCACAATCGTTTCGCAACGGTTCGAGTATTCT
GGCTTTTCAGTCATCAGGCATTCAGACGCAGCAGCAGGATGTCAGGCTCGCCAAATTTTCCACCGTGGTATGCCC
AGATTTCATTTATGAGCTCGTGGCCGGGCTCGCATGCTAATGCTGTCGCAGTCTTCGCAGATCTTTCTGCAAGCC
CAGGACGGGCTGACGGAAATCCGCGTGGTCGACGGCATTCCCATGGCTACGCTGCGTGCGGCGAGCTTGCGGGAT
CTCTTTCACCGCCAGGATACGCAGAACCCTGCCATCGTGCACGAGTATCACGTCTGGGAGCTGGCGAGTATCCTT
TTTGACCGACTTGACCCTTCGGACCTGGCCGACGGTGAAGACTTGGCGAGGAGGTCGAAGCTATCTCAGTTCTGG
ACCGACATGGTGGAGCCGGCGTCGACGACGAATATCGGTCTCGCGAGCTGCAGCGAAGAACGCGCCGTGGCGTGT
GTGGCGGGACATCGGATCTCGGACGCCTGCAAGTTCCTGCTGGAAGGCAAAAACTTTCATCTCGGCACTCTCGTG
CCGCTCATAGGCACCAGCGACGAGGCCAAAAAGGAGATGAGAGGGCAACTCAAGGCCTGGCACGATTCCAAGATG
CTGTCCGAGTTCTCGGCCGCGACGCGGACCATTTACGAGCTCTTGGGCGGCAACGCCTGTGTCTGCGAAGGGATG
AAGGGAGTGCCTGTCGAGGATCGCTTGGACTCGTTCGTCATCTCCAAAAAGTTTGGACTCGACTGGCGGCAGTCA
TTCGGCCTTCGGCTGTGGTACGCCATCAACGAGCGGGATGGTGTGGCGGCGGCAGTCAGAATGTTCGAGGAGGAC
ATAAGCCAAGACAAGGAGAATTTGCCGCAGCCGTGGTTCATTGACGAGGGCATCTTACCGCTATGGAACGATCCG
GACGCGACGCGACGGCAGGATCTTCTCTGGGGGCTGTTGCGGCTTTACGCGGACGAGCACGACGACCTTGAAGCC
GTGCTTCGCCCGGAGAATTCGCAGCTGTCTCCTCTCGACATGCGACTCAGTTGGCAGTTGGGCGTGGCCTTGACC
TCGACCGGCAAGGTTTCGTTTGGGCAAAAGGGCTTGGAGAAGGCAGACGCTTCGACGCTGGCTTACGCCACGCAG
TTGACGGCCGCCGGCGAGTGGCTCGAGGCCGTCTTCGTTCTGCTGCACTTGCAAGACGCCAGTGCACGAGCCAGG
GCGATACAGGAGCATCTCTGTCGACATGCGGGCTTGATCGGCCCTGAGACCGGGACGACGTTTTCGGTCCTGGTC
GACAAGTTTCGCATCCCCACGACCTGGCTGTGGGAGGCGCAAGCTCTGTACATGCGCAGCGTTGCCCACGATGCA
TCAGCCGAGGTGCACTGCCTGCTCCGAGCCGGGTCGTTTGCAGAAGCGCACCGGGTTTTGGTGCAGCAAGTGGCG
CCGCGGGCCATTATCGAGCGCGACTATGCAGCGCTGTCGGCTGTCGTGTGCCCAATCGAAGAGCGGCGGGACTCG
ATTCCCGGATGGGCCTTGGGCGGCCAGGTCTACAGCAGCTTCCTCACCCTTCTGCAGCATCGCGAGCGGTGCGAG
AGCGTTTCGCCGGCGCTGCTGGAGAAGCTCTTGAGCGGCCTCGGGGCCATGAGTGACAGCGTGGGCGAGGTCGAA
GGCGAGATTGAGCGATTCGCCGCCGTTGCCGACATGGCGGACGAGACGGCACGAGAGATTTTGAAGTTGAGCAAG
ACGAAGCAGGTAAAGTCTTGTTCTCTGCGGAATGGTTGTCACTGGCACCGGCTAACGTGTTGACGGTTAGGACAT
GGAGCTACGGTCTCGGATACTCGGGCTGCCTCTGACGCAGGATCGGCTGTTGGCCTACTCGGTGGACCTCGGCAT
AGATTGCTACCGTGAGGTGATGTCGCACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail