Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|308
Gene name
Locationscaffold_107:8090..8600
Strand+
Gene length (bp)510
Transcript length (bp)510
Coding sequence length (bp)507
Protein length (aa) 169

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09811 Yae1_N Essential protein Yae1, N terminal 8.8E-09 20 58

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7Q1|YQ68_SCHPO Uncharacterized ORAOV1 family protein C191.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC191.08 PE=3 SV=1 7 103 6.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|308
MTPDPLEDVLQLEERYYREGYQQGLDDGARAGRIEGRSFGMEKGYEKFLEGGRLAGKAVVWANRLTRREDDATSD
RMPHRGHHDQLNASQNNMPCRTDSDQPDVSSQLKRCVLPPLPSNPRTDKNVRALYALVEPGTLSTENTDEAVQDF
DSRMKRAQGKAKMIERVVG
Coding >Ophio5|308
ATGACTCCTGATCCCCTCGAAGACGTCCTCCAACTAGAGGAGCGCTACTACCGCGAGGGTTACCAGCAAGGTCTT
GACGACGGCGCTCGCGCGGGTCGCATCGAGGGCCGCAGTTTCGGCATGGAAAAGGGCTATGAAAAGTTTCTCGAG
GGAGGTCGTCTGGCTGGCAAGGCGGTCGTCTGGGCCAACAGATTGACCCGTCGAGAAGACGACGCCACTTCTGAC
AGAATGCCTCACCGTGGGCACCATGACCAGCTCAACGCCAGCCAAAACAACATGCCTTGTCGCACAGACTCCGAC
CAGCCCGACGTCTCATCTCAGCTCAAGCGCTGCGTCCTGCCGCCGCTGCCCAGTAACCCACGCACCGACAAGAAC
GTCAGGGCCCTCTACGCGCTCGTAGAGCCGGGGACGCTCTCGACGGAAAACACAGACGAAGCTGTTCAGGACTTC
GACAGCCGCATGAAGCGGGCGCAGGGAAAGGCAAAAATGATTGAGCGAGTCGTCGGC
Transcript >Ophio5|308
ATGACTCCTGATCCCCTCGAAGACGTCCTCCAACTAGAGGAGCGCTACTACCGCGAGGGTTACCAGCAAGGTCTT
GACGACGGCGCTCGCGCGGGTCGCATCGAGGGCCGCAGTTTCGGCATGGAAAAGGGCTATGAAAAGTTTCTCGAG
GGAGGTCGTCTGGCTGGCAAGGCGGTCGTCTGGGCCAACAGATTGACCCGTCGAGAAGACGACGCCACTTCTGAC
AGAATGCCTCACCGTGGGCACCATGACCAGCTCAACGCCAGCCAAAACAACATGCCTTGTCGCACAGACTCCGAC
CAGCCCGACGTCTCATCTCAGCTCAAGCGCTGCGTCCTGCCGCCGCTGCCCAGTAACCCACGCACCGACAAGAAC
GTCAGGGCCCTCTACGCGCTCGTAGAGCCGGGGACGCTCTCGACGGAAAACACAGACGAAGCTGTTCAGGACTTC
GACAGCCGCATGAAGCGGGCGCAGGGAAAGGCAAAAATGATTGAGCGAGTCGTCGGCTAA
Gene >Ophio5|308
ATGACTCCTGATCCCCTCGAAGACGTCCTCCAACTAGAGGAGCGCTACTACCGCGAGGGTTACCAGCAAGGTCTT
GACGACGGCGCTCGCGCGGGTCGCATCGAGGGCCGCAGTTTCGGCATGGAAAAGGGCTATGAAAAGTTTCTCGAG
GGAGGTCGTCTGGCTGGCAAGGCGGTCGTCTGGGCCAACAGATTGACCCGTCGAGAAGACGACGCCACTTCTGAC
AGAATGCCTCACCGTGGGCACCATGACCAGCTCAACGCCAGCCAAAACAACATGCCTTGTCGCACAGACTCCGAC
CAGCCCGACGTCTCATCTCAGCTCAAGCGCTGCGTCCTGCCGCCGCTGCCCAGTAACCCACGCACCGACAAGAAC
GTCAGGGCCCTCTACGCGCTCGTAGAGCCGGGGACGCTCTCGACGGAAAACACAGACGAAGCTGTTCAGGACTTC
GACAGCCGCATGAAGCGGGCGCAGGGAAAGGCAAAAATGATTGAGCGAGTCGTCGGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail