Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3076
Gene name
Locationscaffold_244:19873..22089
Strand+
Gene length (bp)2216
Transcript length (bp)2112
Coding sequence length (bp)2109
Protein length (aa) 703

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11951 Fungal_trans_2 Fungal specific transcription factor domain 1.1E-34 253 701
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 9.5E-09 178 215

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UT46|MOC3_SCHPO Transcriptional regulatory protein moc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=moc3 PE=1 SV=4 139 210 2.0E-09
sp|O74308|YOG2_SCHPO Uncharacterized transcriptional regulatory protein C15D4.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15D4.02 PE=3 SV=3 175 258 1.0E-08
sp|Q9HFR4|ATG2_PICPA Autophagy-related protein 2 OS=Komagataella pastoris GN=ATG2 PE=3 SV=1 170 210 3.0E-07
sp|Q5ANB1|WOR2_CANAL White-opaque regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=WOR2 PE=1 SV=1 179 212 6.0E-07

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0008150 biological_process No
GO:0051252 regulation of RNA metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0019222 regulation of metabolic process No
GO:0050794 regulation of cellular process No
GO:0140110 transcription regulator activity No
GO:0031323 regulation of cellular metabolic process No
GO:0065007 biological regulation No
GO:0046872 metal ion binding No
GO:0010468 regulation of gene expression No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0005488 binding No
GO:0080090 regulation of primary metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0050789 regulation of biological process No
GO:0003700 DNA-binding transcription factor activity No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0046914 transition metal ion binding No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.586 0.8179 0.0313 0.0271 0.1162 0.0147 0.0654 0.0617 0.0581 0.0148

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 33.16 18.08 48.23
CcL In ants, during behavior modification 15.73 7.59 23.87
CcD In ants, recently dead 16.76 8.21 25.32

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.001647 yes
SC16a CcD 0.001437 yes
CcL CcD 0.838461 no

Orthologs

Orthofinder run ID4
Orthogroup891
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1571
Ophiocordyceps australis map64 (Brazil) OphauB2|4549
Ophiocordyceps camponoti-floridani Ophcf2|03131
Ophiocordyceps camponoti-rufipedis Ophun1|3833
Ophiocordyceps camponoti-rufipedis Ophun1|3834
Ophiocordyceps kimflemingae Ophio5|3076 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5622

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3076
MQPKLTLVTDRGAHSYWPGEKKPVAADVMILPSPSPTEAAWGSVMSESVQTGQLSPVSVGIGLPVEGCSTPATAP
SNPPSSANPWDSEMVDDMDQESPCHYLERCVGTASVLPKLEPVDDDINLDLVKLAPSTPPLLRSPISAEPSAKQK
RTRGRPRKMSLTSPVASSTKATNGRSKTGCITCRKRKKKCDEAKPRCMNCEKNAVMCEGYHEKQLWKSGRERAEG
DRRKGERLPTVTMPPLIYGIETSEDRVLWRHYVSHFSNVLTVEGEANNAFKDVILQLANQHQGLMHSLLALSSKH
IDLGSPYGVRMLQSHPGTSRESLQRRAEFHHAEALKRLYEDLEKSLGKDDPEYQTMLAGRYGQILCLLLQTRTDG
NPRGEHRLHLQAYQSLIQQSPPGDAAFNTFVTEFFQYHVYADDLFWHPAMMTRRLSTESWQPSAPIEAPRLLGVA
DGLFTQLAQITSIRNAIREKMAASADPVVDHAILSRAVDIDAAIREWSPRWPPGDSRNRVAPLYRQVMWVYLFRT
IYPPWRRVTEPSPSPQPSEGPPRRRDSAVVARRGDAAEPGNPSPGACTTTWKPWRPGSTQTSDSRSAEARHPVLE
DGRMTLAVDESLSILESFRPSDPIQTLLLVPCLLIGTACFQPAQRDRIRSAVRLVRGYTGLRSCDRATELLEELW
SLMDEADWLSVWDWQGVARRMELDFLCA
Coding >Ophio5|3076
ATGCAGCCAAAACTCACACTTGTGACGGATCGAGGAGCCCACTCTTACTGGCCAGGAGAGAAGAAGCCCGTTGCG
GCCGATGTCATGATTCTGCCATCGCCTTCCCCAACGGAAGCTGCTTGGGGCTCCGTGATGAGTGAGTCGGTCCAG
ACAGGCCAGCTGTCGCCCGTCAGTGTCGGCATCGGTCTGCCGGTCGAAGGCTGCTCCACGCCGGCAACGGCCCCT
TCGAACCCACCTTCGTCCGCCAACCCCTGGGACAGCGAGATGGTCGACGACATGGACCAAGAGAGCCCCTGTCAT
TATTTGGAGCGATGCGTTGGCACCGCCTCGGTCCTTCCCAAGCTAGAACCGGTCGATGACGATATAAATCTTGAC
CTCGTGAAGCTCGCCCCGTCGACGCCGCCACTGTTGCGAAGCCCCATCTCAGCCGAACCCTCGGCCAAGCAGAAA
CGCACCCGAGGACGGCCGAGGAAGATGTCCCTAACCAGTCCGGTCGCCAGCTCCACAAAGGCGACGAATGGGCGG
TCCAAGACGGGCTGTATTACCTGCAGGAAGAGGAAGAAGAAATGTGATGAGGCCAAGCCACGATGCATGAACTGC
GAGAAGAACGCGGTCATGTGCGAGGGCTATCACGAGAAGCAGCTGTGGAAGAGCGGGAGAGAGAGGGCGGAAGGG
GATCGACGTAAAGGCGAGCGTCTACCTACCGTCACGATGCCGCCGCTCATCTACGGTATCGAGACGAGCGAGGAC
AGGGTCCTGTGGAGGCACTACGTCAGTCACTTTAGCAATGTCTTGACGGTCGAAGGCGAGGCCAACAACGCCTTC
AAAGACGTCATCCTGCAGCTTGCCAACCAGCACCAAGGGCTGATGCACTCGTTGCTGGCCCTGAGCAGCAAGCAC
ATCGACCTCGGCTCCCCTTACGGCGTCCGGATGCTCCAGAGCCACCCCGGCACGAGTCGTGAGTCCCTGCAGCGG
CGGGCCGAGTTTCACCACGCCGAGGCGTTGAAGCGACTATACGAAGACCTGGAGAAGTCGCTGGGCAAGGACGAT
CCCGAGTACCAGACGATGCTGGCCGGAAGATACGGGCAGATCCTCTGTCTCTTGCTGCAGACAAGAACCGACGGC
AACCCGAGGGGTGAGCATAGGCTCCATCTGCAGGCCTACCAGAGCCTAATACAGCAATCGCCACCCGGAGACGCG
GCTTTCAACACGTTCGTGACCGAGTTCTTTCAGTATCACGTCTATGCCGACGACCTCTTCTGGCACCCGGCCATG
ATGACGAGGCGGCTCTCGACGGAGAGCTGGCAGCCCTCGGCGCCGATCGAGGCGCCCCGACTCTTGGGCGTCGCC
GACGGCCTGTTCACGCAGCTGGCACAGATTACGAGCATCCGCAATGCGATACGGGAGAAGATGGCCGCCTCGGCG
GATCCGGTCGTTGACCACGCCATACTGTCCCGGGCCGTCGACATCGACGCCGCCATCAGAGAATGGTCTCCTCGG
TGGCCGCCCGGGGACAGCCGGAACCGCGTTGCGCCGCTGTACAGGCAGGTCATGTGGGTGTACCTCTTCCGGACC
ATCTACCCACCATGGCGCCGGGTGACGGAGCCATCGCCATCGCCGCAGCCGTCCGAGGGGCCTCCTCGGCGTCGG
GACTCGGCGGTGGTCGCCAGACGCGGCGACGCGGCGGAGCCGGGCAACCCATCGCCGGGCGCTTGCACGACGACA
TGGAAGCCATGGCGGCCTGGCTCAACGCAGACGTCGGACTCGCGGTCAGCGGAGGCACGGCATCCCGTCCTCGAA
GACGGGCGCATGACGCTGGCCGTGGACGAGTCGCTCTCGATCCTCGAGTCCTTCCGGCCGTCGGACCCGATCCAG
ACGCTCCTACTGGTGCCATGCCTGCTTATCGGCACGGCCTGCTTCCAGCCAGCGCAGCGCGACCGCATCCGCTCC
GCCGTCCGGCTCGTCCGCGGCTACACGGGTCTGCGCAGCTGCGACCGCGCCACCGAGCTGCTCGAGGAGCTGTGG
TCGCTCATGGACGAGGCAGACTGGCTCTCTGTCTGGGACTGGCAGGGCGTGGCGAGGAGGATGGAGCTGGATTTT
CTCTGCGCC
Transcript >Ophio5|3076
ATGCAGCCAAAACTCACACTTGTGACGGATCGAGGAGCCCACTCTTACTGGCCAGGAGAGAAGAAGCCCGTTGCG
GCCGATGTCATGATTCTGCCATCGCCTTCCCCAACGGAAGCTGCTTGGGGCTCCGTGATGAGTGAGTCGGTCCAG
ACAGGCCAGCTGTCGCCCGTCAGTGTCGGCATCGGTCTGCCGGTCGAAGGCTGCTCCACGCCGGCAACGGCCCCT
TCGAACCCACCTTCGTCCGCCAACCCCTGGGACAGCGAGATGGTCGACGACATGGACCAAGAGAGCCCCTGTCAT
TATTTGGAGCGATGCGTTGGCACCGCCTCGGTCCTTCCCAAGCTAGAACCGGTCGATGACGATATAAATCTTGAC
CTCGTGAAGCTCGCCCCGTCGACGCCGCCACTGTTGCGAAGCCCCATCTCAGCCGAACCCTCGGCCAAGCAGAAA
CGCACCCGAGGACGGCCGAGGAAGATGTCCCTAACCAGTCCGGTCGCCAGCTCCACAAAGGCGACGAATGGGCGG
TCCAAGACGGGCTGTATTACCTGCAGGAAGAGGAAGAAGAAATGTGATGAGGCCAAGCCACGATGCATGAACTGC
GAGAAGAACGCGGTCATGTGCGAGGGCTATCACGAGAAGCAGCTGTGGAAGAGCGGGAGAGAGAGGGCGGAAGGG
GATCGACGTAAAGGCGAGCGTCTACCTACCGTCACGATGCCGCCGCTCATCTACGGTATCGAGACGAGCGAGGAC
AGGGTCCTGTGGAGGCACTACGTCAGTCACTTTAGCAATGTCTTGACGGTCGAAGGCGAGGCCAACAACGCCTTC
AAAGACGTCATCCTGCAGCTTGCCAACCAGCACCAAGGGCTGATGCACTCGTTGCTGGCCCTGAGCAGCAAGCAC
ATCGACCTCGGCTCCCCTTACGGCGTCCGGATGCTCCAGAGCCACCCCGGCACGAGTCGTGAGTCCCTGCAGCGG
CGGGCCGAGTTTCACCACGCCGAGGCGTTGAAGCGACTATACGAAGACCTGGAGAAGTCGCTGGGCAAGGACGAT
CCCGAGTACCAGACGATGCTGGCCGGAAGATACGGGCAGATCCTCTGTCTCTTGCTGCAGACAAGAACCGACGGC
AACCCGAGGGGTGAGCATAGGCTCCATCTGCAGGCCTACCAGAGCCTAATACAGCAATCGCCACCCGGAGACGCG
GCTTTCAACACGTTCGTGACCGAGTTCTTTCAGTATCACGTCTATGCCGACGACCTCTTCTGGCACCCGGCCATG
ATGACGAGGCGGCTCTCGACGGAGAGCTGGCAGCCCTCGGCGCCGATCGAGGCGCCCCGACTCTTGGGCGTCGCC
GACGGCCTGTTCACGCAGCTGGCACAGATTACGAGCATCCGCAATGCGATACGGGAGAAGATGGCCGCCTCGGCG
GATCCGGTCGTTGACCACGCCATACTGTCCCGGGCCGTCGACATCGACGCCGCCATCAGAGAATGGTCTCCTCGG
TGGCCGCCCGGGGACAGCCGGAACCGCGTTGCGCCGCTGTACAGGCAGGTCATGTGGGTGTACCTCTTCCGGACC
ATCTACCCACCATGGCGCCGGGTGACGGAGCCATCGCCATCGCCGCAGCCGTCCGAGGGGCCTCCTCGGCGTCGG
GACTCGGCGGTGGTCGCCAGACGCGGCGACGCGGCGGAGCCGGGCAACCCATCGCCGGGCGCTTGCACGACGACA
TGGAAGCCATGGCGGCCTGGCTCAACGCAGACGTCGGACTCGCGGTCAGCGGAGGCACGGCATCCCGTCCTCGAA
GACGGGCGCATGACGCTGGCCGTGGACGAGTCGCTCTCGATCCTCGAGTCCTTCCGGCCGTCGGACCCGATCCAG
ACGCTCCTACTGGTGCCATGCCTGCTTATCGGCACGGCCTGCTTCCAGCCAGCGCAGCGCGACCGCATCCGCTCC
GCCGTCCGGCTCGTCCGCGGCTACACGGGTCTGCGCAGCTGCGACCGCGCCACCGAGCTGCTCGAGGAGCTGTGG
TCGCTCATGGACGAGGCAGACTGGCTCTCTGTCTGGGACTGGCAGGGCGTGGCGAGGAGGATGGAGCTGGATTTT
CTCTGCGCCTGA
Gene >Ophio5|3076
ATGCAGCCAAAACTCACACTTGTGACGGATCGAGGAGCCCACTCTTACTGGCCAGGAGAGAAGAAGCCCGTTGCG
GCCGATGTCATGATTCTGCCATCGCCTTCCCCAACGGAAGCTGCTTGGGGCTCCGTGATGAGTGAGTCGGTCCAG
ACAGGCCAGCTGTCGCCCGTCAGTGTCGGCATCGGTCTGCCGGTCGAAGGCTGCTCCACGCCGGCAACGGCCCCT
TCGAACCCACCTTCGTCCGCCAACCCCTGGGACAGCGAGATGGTCGACGACATGGACCAAGAGAGCCCCTGTCAT
TATTTGGAGCGATGCGTTGGCACCGCCTCGGTCCTTCCCAAGCTAGAACCGGTCGATGACGATATAAATCTTGAC
CTCGTGAAGCTCGCCCCGTCGACGCCGCCACTGTTGCGAAGCCCCATCTCAGCCGAACCCTCGGCCAAGCAGAAA
CGCACCCGAGGACGGCCGAGGAAGATGTCCCTAACCAGTCCGGTCGCCAGCTCCACAAAGGCGACGAATGGGCGG
TCCAAGACGGGCTGTATTACCTGCAGGAAGAGGAAGAAGAAATGTGATGAGGCCAAGCCACGATGTACGCCTCGC
TTTTTTCCTCGACGGCCTCTCGATACTGACTTTGCCGGCAAAAGGCATGAACTGCGAGAAGAACGCGGTCATGTG
CGAGGGCTATCACGAGAAGCAGCTGTGGAAGAGCGGGAGAGAGAGGGCGGAAGGGGGTGAGTCTGCCTCGTCTGT
GCGGCGAGCGGCCGGCTGACGACAGTCAAGATCGACGTAAAGGCGAGCGTCTACCTACCGTCACGATGCCGCCGC
TCATCTACGGTATCGAGACGAGCGAGGACAGGGTCCTGTGGAGGCACTACGTCAGTCACTTTAGCAATGTCTTGA
CGGTCGAAGGCGAGGCCAACAACGCCTTCAAAGACGTCATCCTGCAGCTTGCCAACCAGCACCAAGGGCTGATGC
ACTCGTTGCTGGCCCTGAGCAGCAAGCACATCGACCTCGGCTCCCCTTACGGCGTCCGGATGCTCCAGAGCCACC
CCGGCACGAGTCGTGAGTCCCTGCAGCGGCGGGCCGAGTTTCACCACGCCGAGGCGTTGAAGCGACTATACGAAG
ACCTGGAGAAGTCGCTGGGCAAGGACGATCCCGAGTACCAGACGATGCTGGCCGGAAGATACGGGCAGATCCTCT
GTCTCTTGCTGCAGACAAGAACCGACGGCAACCCGAGGGGTGAGCATAGGCTCCATCTGCAGGCCTACCAGAGCC
TAATACAGCAATCGCCACCCGGAGACGCGGCTTTCAACACGTTCGTGACCGAGTTCTTTCAGTATCACGTCTATG
CCGACGACCTCTTCTGGCACCCGGCCATGATGACGAGGCGGCTCTCGACGGAGAGCTGGCAGCCCTCGGCGCCGA
TCGAGGCGCCCCGACTCTTGGGCGTCGCCGACGGCCTGTTCACGCAGCTGGCACAGATTACGAGCATCCGCAATG
CGATACGGGAGAAGATGGCCGCCTCGGCGGATCCGGTCGTTGACCACGCCATACTGTCCCGGGCCGTCGACATCG
ACGCCGCCATCAGAGAATGGTCTCCTCGGTGGCCGCCCGGGGACAGCCGGAACCGCGTTGCGCCGCTGTACAGGC
AGGTCATGTGGGTGTACCTCTTCCGGACCATCTACCCACCATGGCGCCGGGTGACGGAGCCATCGCCATCGCCGC
AGCCGTCCGAGGGGCCTCCTCGGCGTCGGGACTCGGCGGTGGTCGCCAGACGCGGCGACGCGGCGGAGCCGGGCA
ACCCATCGCCGGGCGCTTGCACGACGACATGGAAGCCATGGCGGCCTGGCTCAACGCAGACGTCGGACTCGCGGT
CAGCGGAGGCACGGCATCCCGTCCTCGAAGACGGGCGCATGACGCTGGCCGTGGACGAGTCGCTCTCGATCCTCG
AGTCCTTCCGGCCGTCGGACCCGATCCAGACGCTCCTACTGGTGCCATGCCTGCTTATCGGCACGGCCTGCTTCC
AGCCAGCGCAGCGCGACCGCATCCGCTCCGCCGTCCGGCTCGTCCGCGGCTACACGGGTCTGCGCAGCTGCGACC
GCGCCACCGAGCTGCTCGAGGAGCTGTGGTCGCTCATGGACGAGGCAGACTGGCTCTCTGTCTGGGACTGGCAGG
GCGTGGCGAGGAGGATGGAGCTGGATTTTCTCTGCGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail