Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3070
Gene name
Locationscaffold_244:3123..4562
Strand-
Gene length (bp)1439
Transcript length (bp)1380
Coding sequence length (bp)1377
Protein length (aa) 459

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q7YRB2|CP8B1_PIG 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase OS=Sus scrofa GN=CYP8B1 PE=2 SV=1 323 454 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

Domain # Start End Length
1 15 32 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3070
MEVHVRRLVPGGDWAVMLAGFTAALMAVLLALTRSRRTITTTPSTSTTKSWSCPPRVPFRIPFIGHTIQMALDAN
GFLARLRDRYPEGVFSLRLCGRLHHFVHGPRMATTLLNRPRTTAETLSGGLLVSNFGFSEEDRLHHAGLAAESRE
NFRLLLSEPGLSHLVKSTVGHVCDHVGRLVCFDEQEQQQQQQQQQQQQQQQQQQQQPEWARMAGAKMVSGQGERV
VEAELIELTRNFVAMTANRALFGSDFVDNMPDLWSWLWKFDEAFLLLAARLPGWIPWPRLREARRAQRRLLSHAR
DFNTAVDRQVSGQDPGPRWRRLHQVSGFVTARHNTYRQHGLSLAARASSDLALLWAMNANANLLVPWMLFELYQR
PELLRAIRSEIGPFIRIADDDDDDDEAIEQVDVKGLLERCPRLKAAYVETLRLYTGPWTMRKLREDVVLGGKGGV
GSRVFPRAD
Coding >Ophio5|3070
ATGGAAGTGCATGTTCGGCGACTGGTGCCCGGTGGCGACTGGGCTGTTATGCTGGCTGGCTTTACGGCTGCGCTT
ATGGCTGTCTTGCTGGCCTTGACACGCAGCCGGCGAACAATAACAACTACACCATCAACGTCGACAACGAAATCA
TGGTCCTGCCCTCCGCGGGTGCCGTTCCGGATCCCCTTTATCGGCCACACAATACAGATGGCCTTGGACGCAAAT
GGATTCCTGGCTCGACTGCGGGATCGATACCCAGAAGGCGTCTTCTCACTACGTCTATGTGGACGGCTGCACCAC
TTCGTGCACGGGCCGCGTATGGCGACCACTCTTCTGAACCGGCCGCGGACGACGGCCGAGACGCTCTCCGGCGGC
TTACTGGTATCCAATTTCGGCTTCAGCGAAGAGGACCGTCTTCATCATGCCGGGCTGGCGGCCGAGTCGAGGGAG
AATTTCCGTCTGCTTCTCTCCGAGCCTGGTTTAAGTCATCTGGTAAAGTCGACGGTTGGTCATGTGTGCGACCAT
GTTGGAAGGCTTGTTTGCTTTGATGAGCAAGAACAACAACAACAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAG
CAGCAGCAGCAGCAGCAGCCTGAGTGGGCTCGTATGGCGGGCGCCAAGATGGTGTCTGGTCAGGGGGAGAGGGTG
GTGGAGGCGGAGCTGATTGAGTTGACGCGCAACTTTGTGGCCATGACGGCCAATCGGGCTTTATTTGGGAGCGAT
TTCGTCGATAATATGCCTGACTTGTGGTCTTGGTTGTGGAAGTTTGACGAGGCCTTCTTATTGTTGGCTGCTCGA
CTACCGGGCTGGATTCCCTGGCCGAGATTACGAGAGGCTCGAAGGGCCCAACGACGGTTACTGTCTCACGCACGA
GACTTTAACACGGCCGTCGACAGACAGGTTTCGGGACAGGATCCGGGCCCACGATGGCGTCGACTCCATCAAGTG
AGCGGCTTCGTCACCGCCCGACACAACACCTACCGCCAACATGGACTCTCGCTCGCGGCGCGAGCGAGTAGCGAC
CTAGCACTCCTCTGGGCCATGAACGCCAACGCGAACCTCCTGGTGCCCTGGATGCTATTCGAACTTTACCAACGG
CCGGAACTACTCCGCGCCATCCGCTCCGAAATAGGTCCCTTCATACGAATTGCCGACGACGACGACGACGACGAC
GAAGCAATCGAACAGGTTGACGTTAAAGGACTTTTGGAACGCTGTCCGCGTCTCAAAGCTGCCTACGTCGAGACC
TTGAGGCTATACACGGGCCCCTGGACGATGCGAAAGCTGAGAGAAGACGTCGTCCTCGGCGGGAAAGGAGGTGTT
GGATCCCGAGTATTTCCCCGAGCCGAC
Transcript >Ophio5|3070
ATGGAAGTGCATGTTCGGCGACTGGTGCCCGGTGGCGACTGGGCTGTTATGCTGGCTGGCTTTACGGCTGCGCTT
ATGGCTGTCTTGCTGGCCTTGACACGCAGCCGGCGAACAATAACAACTACACCATCAACGTCGACAACGAAATCA
TGGTCCTGCCCTCCGCGGGTGCCGTTCCGGATCCCCTTTATCGGCCACACAATACAGATGGCCTTGGACGCAAAT
GGATTCCTGGCTCGACTGCGGGATCGATACCCAGAAGGCGTCTTCTCACTACGTCTATGTGGACGGCTGCACCAC
TTCGTGCACGGGCCGCGTATGGCGACCACTCTTCTGAACCGGCCGCGGACGACGGCCGAGACGCTCTCCGGCGGC
TTACTGGTATCCAATTTCGGCTTCAGCGAAGAGGACCGTCTTCATCATGCCGGGCTGGCGGCCGAGTCGAGGGAG
AATTTCCGTCTGCTTCTCTCCGAGCCTGGTTTAAGTCATCTGGTAAAGTCGACGGTTGGTCATGTGTGCGACCAT
GTTGGAAGGCTTGTTTGCTTTGATGAGCAAGAACAACAACAACAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAG
CAGCAGCAGCAGCAGCAGCCTGAGTGGGCTCGTATGGCGGGCGCCAAGATGGTGTCTGGTCAGGGGGAGAGGGTG
GTGGAGGCGGAGCTGATTGAGTTGACGCGCAACTTTGTGGCCATGACGGCCAATCGGGCTTTATTTGGGAGCGAT
TTCGTCGATAATATGCCTGACTTGTGGTCTTGGTTGTGGAAGTTTGACGAGGCCTTCTTATTGTTGGCTGCTCGA
CTACCGGGCTGGATTCCCTGGCCGAGATTACGAGAGGCTCGAAGGGCCCAACGACGGTTACTGTCTCACGCACGA
GACTTTAACACGGCCGTCGACAGACAGGTTTCGGGACAGGATCCGGGCCCACGATGGCGTCGACTCCATCAAGTG
AGCGGCTTCGTCACCGCCCGACACAACACCTACCGCCAACATGGACTCTCGCTCGCGGCGCGAGCGAGTAGCGAC
CTAGCACTCCTCTGGGCCATGAACGCCAACGCGAACCTCCTGGTGCCCTGGATGCTATTCGAACTTTACCAACGG
CCGGAACTACTCCGCGCCATCCGCTCCGAAATAGGTCCCTTCATACGAATTGCCGACGACGACGACGACGACGAC
GAAGCAATCGAACAGGTTGACGTTAAAGGACTTTTGGAACGCTGTCCGCGTCTCAAAGCTGCCTACGTCGAGACC
TTGAGGCTATACACGGGCCCCTGGACGATGCGAAAGCTGAGAGAAGACGTCGTCCTCGGCGGGAAAGGAGGTGTT
GGATCCCGAGTATTTCCCCGAGCCGACTGA
Gene >Ophio5|3070
ATGGAAGTGCATGTTCGGCGACTGGTGCCCGGTGGCGACTGGGCTGTTATGCTGGCTGGCTTTACGGCTGCGCTT
ATGGCTGTCTTGCTGGCCTTGACACGCAGCCGGCGAACAATAACAACTACACCATCAACGTCGACAACGAAATCA
TGGTCCTGCCCTCCGCGGGTGCCGTTCCGGATCCCCTTTATCGGCCACACAATACAGATGGCCTTGGACGCAAAT
GGATTCCTGGCTCGACTGCGGGATCGATACCCAGAAGGCGTCTTCTCACTACGTCTATGTGGACGGCTGCACCAC
TTCGTGCACGGGCCGCGTATGGCGACCACTCTTCTGAACCGGCCGCGGACGACGGCCGAGACGCTCTCCGGCGGC
TTACTGGTATCCAATTTCGGCTTCAGCGAAGAGGACCGTCTTCATCATGCCGGGCTGGCGGCCGAGTCGAGGGAG
AATTTCCGTCTGCTTCTCTCCGAGCCTGGTTTAAGTCATCTGGTAAAGTCGACGGTTGGTCATGTGTGCGACCAT
GTTGGAAGGCTTGTTTGCTTTGATGAGCAAGAACAACAACAACAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAG
CAGCAGCAGCAGCAGCAGCCTGAGTGGGCTCGTATGGCGGGCGCCAAGATGGTGTCTGGTCAGGGGGAGAGGGTG
GTGGAGGCGGAGCTGATTGAGTTGACGCGCAACTTTGTGGCCATGACGGCCAATCGGGCTTTATTTGGGAGCGAT
TTCGTCGATAATATGCCTGACTTGTGGTCTTGGTTGTGGAAGTTTGACGAGGCCTTCTTATTGTTGGCTGCTCGA
CTACCGGGCTGGATTCCCTGGCCGAGATTACGAGAGGCTCGAAGGGCCCAACGACGGTTACTGTCTCACGCACGA
GACTTTAACACGGCCGTCGACAGACAGGTTTCGGGACAGGATCCGGGCCCACGATGGCGTCGACTCCATCAAGTG
AGCGGCTTCGTCACCGCCCGACACAACACCTACCGCCAACATGGACTCTCGCTCGCGGCGCGAGCGAGTAGCGAC
CTAGCACTCCTCTGGGCCATGAACGCCAACGCGAACCTCCTGGTGCCCTGGATGCTATTCGAACTTTACCAACGG
CCGGAACTACTCCGCGCCATCCGCTCCGAAATAGGTCCCTTCATACGAATTGCCGACGACGACGACGACGACGAC
GAAGCAATCGAACAGGTTGACGTTAAAGGACTTTTGGAACGCTGTCCGCGTCTCAAAGCTGCCTACGTCGAGACC
TTGAGGCTATACACGGGCCCCTGGACGATGCGAAAGCTGAGAGAAGACGTCGTCCTCGGCGGGAAAGGAGGTGGT
GAGCCGTTCGTGTTGCGCAAGGGGAGCTTTGCCCATGTGGCGCATGAGATGCATCAGTTGGATCCCGAGTATTTC
CCCGAGCCGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail