Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3065
Gene name
Locationscaffold_243:15688..18240
Strand-
Gene length (bp)2552
Transcript length (bp)2310
Coding sequence length (bp)2310
Protein length (aa) 770

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05185 PRMT5 PRMT5 arginine-N-methyltransferase 6.8E-65 387 564
PF17285 PRMT5_TIM PRMT5 TIM barrel domain 1.9E-64 47 316
PF17286 PRMT5_C PRMT5 oligomerisation domain 7.5E-42 567 754

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78963|SKB1_SCHPO Protein arginine N-methyltransferase skb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=skb1 PE=1 SV=2 101 754 2.0E-121
sp|Q6NUA1|ANM5_XENLA Protein arginine N-methyltransferase 5 OS=Xenopus laevis GN=prmt5 PE=1 SV=1 41 762 2.0E-90
sp|Q5R698|ANM5_PONAB Protein arginine N-methyltransferase 5 OS=Pongo abelii GN=PRMT5 PE=2 SV=3 41 762 3.0E-89
sp|O14744|ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 41 762 9.0E-89
sp|Q4R5M3|ANM5_MACFA Protein arginine N-methyltransferase 5 OS=Macaca fascicularis GN=PRMT5 PE=2 SV=3 41 762 4.0E-88
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78963|SKB1_SCHPO Protein arginine N-methyltransferase skb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=skb1 PE=1 SV=2 101 754 2.0E-121
sp|Q6NUA1|ANM5_XENLA Protein arginine N-methyltransferase 5 OS=Xenopus laevis GN=prmt5 PE=1 SV=1 41 762 2.0E-90
sp|Q5R698|ANM5_PONAB Protein arginine N-methyltransferase 5 OS=Pongo abelii GN=PRMT5 PE=2 SV=3 41 762 3.0E-89
sp|O14744|ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 41 762 9.0E-89
sp|Q4R5M3|ANM5_MACFA Protein arginine N-methyltransferase 5 OS=Macaca fascicularis GN=PRMT5 PE=2 SV=3 41 762 4.0E-88
sp|A7YW45|ANM5_BOVIN Protein arginine N-methyltransferase 5 OS=Bos taurus GN=PRMT5 PE=2 SV=1 41 762 8.0E-88
sp|Q8CIG8|ANM5_MOUSE Protein arginine N-methyltransferase 5 OS=Mus musculus GN=Prmt5 PE=1 SV=3 41 762 2.0E-87
sp|Q8GWT4|ANM15_ARATH Protein arginine N-methyltransferase 1.5 OS=Arabidopsis thaliana GN=PMRT15 PE=1 SV=2 97 754 5.0E-87
sp|Q6YXZ7|ANM5_ORYSJ Protein arginine N-methyltransferase 5 OS=Oryza sativa subsp. japonica GN=PRMT5 PE=2 SV=1 97 754 7.0E-86
sp|A2X0Q3|ANM5_ORYSI Protein arginine N-methyltransferase 5 OS=Oryza sativa subsp. indica GN=PRMT5 PE=3 SV=2 97 754 2.0E-85
sp|Q54KI3|ANM5_DICDI Protein arginine N-methyltransferase 5 OS=Dictyostelium discoideum GN=prmt5 PE=3 SV=1 122 735 1.0E-68
sp|P38274|HSL7_YEAST Protein arginine N-methyltransferase HSL7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL7 PE=1 SV=1 50 752 1.0E-68
sp|Q9U6Y9|ANM5_DROME Protein arginine N-methyltransferase 5 OS=Drosophila melanogaster GN=csul PE=1 SV=2 230 754 2.0E-52
sp|P46580|ANM5_CAEEL Protein arginine N-methyltransferase 5 OS=Caenorhabditis elegans GN=prmt-5 PE=1 SV=2 118 754 6.0E-51
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3065
MASSESSAPVEGQSPGSRQPIFHIGNHDSTRDVPLTDLQYGHLLNQGISFATTPITNSRFKDSIFKLVSDYMTLL
DHNGETATSTTSASRAGPILPPLTPEDTGLFPSSTVTTCTAFVSPWIDLCSSDPIIASVSRQVLNLEINYANFCG
VRSIVVTGPLRDACNGGNQGLVQFSRAVHEALTIGNCVSFLIHMPMYREPNGIDSVETLSSLKPQKPEIEMKVID
LFSCWDSWHHIRTVCRYNSRLFVALKLPRMMPEKELQGRWFAEPVHFLTIGPDVFQINRNGYPCFSRHHQEMIFA
HMRLKATPWLLLCDVGPDASQFRAHSPSLLAAPPPVTDEDFPTLAEAHEPFDAPQGRSPCGNAHMAYLQWLESQQ
PLLSALESTTLISFQDWLQSPLQPLSDNLESATYEVFEGDPVKYNRYEDAVVDALSDWRELGLPTSKKGVVVVAV
AGSGRGPLVTRALRAAELTGVAIEVWAVEKNPNAYVYLLRQNQTEWGGRVNVVKADMRTWKGPIVSERADTGPVY
GKVDVLISELLGSFGDNELSPECLDGIQHVLAEPHGISIPSSYTAHLSPVSDPKVYAEILTRSAVDATAFDTPWV
VRLYALDFVCQRVPHHPRFQQAWEFSHPIPDSTLQAIQYRRSGGVVGGGGGSMAGAAGANDHNSRFCHLTFVCRC
PGVIHGLAGYFESTLYESKLEGGEGAKVEISTHPERMDSKSKDMASWFPIFFPLREPLTYPYDSELEVSMWRQTD
DTRIATSALCSSRKVACLM*
Coding >Ophio5|3065
ATGGCTTCTTCCGAAAGCTCCGCGCCGGTCGAGGGCCAAAGCCCAGGCTCTCGGCAACCCATTTTTCACATCGGC
AACCACGATTCGACCCGAGACGTTCCTCTCACTGACTTGCAATACGGCCATCTGTTGAATCAGGGTATCAGCTTT
GCGACCACGCCCATAACCAACAGCCGCTTTAAAGACAGCATCTTCAAGCTCGTTTCGGACTATATGACGTTGCTG
GACCACAACGGCGAGACTGCAACCAGCACCACCTCGGCGTCTCGGGCTGGCCCCATCCTACCTCCCCTGACCCCC
GAAGACACCGGTCTGTTCCCGTCATCGACAGTCACCACCTGCACGGCTTTTGTGAGCCCATGGATCGACCTCTGC
TCCTCGGACCCTATCATCGCCAGCGTCTCCCGCCAGGTGCTGAACCTCGAGATCAACTACGCCAATTTTTGCGGT
GTCAGGAGCATCGTCGTCACCGGGCCGCTTCGTGATGCGTGCAACGGTGGCAATCAAGGGTTGGTTCAGTTTTCT
CGTGCCGTACATGAGGCCCTGACCATTGGCAACTGCGTATCCTTCTTAATTCACATGCCCATGTACCGAGAGCCC
AACGGCATTGACTCGGTCGAAACGCTCTCATCGTTGAAGCCTCAGAAGCCTGAAATTGAGATGAAAGTGATCGAT
CTCTTCAGCTGTTGGGACTCTTGGCATCACATTCGAACGGTGTGCCGCTACAATTCAAGGCTTTTCGTTGCCCTC
AAGCTGCCCAGAATGATGCCAGAGAAGGAACTGCAGGGTCGGTGGTTTGCGGAGCCTGTTCACTTTCTCACCATA
GGGCCAGATGTCTTCCAGATCAACAGGAATGGCTACCCCTGCTTCTCCAGACACCATCAGGAGATGATATTTGCT
CACATGCGGCTCAAGGCTACGCCCTGGCTGCTTCTGTGTGACGTCGGCCCCGACGCCTCCCAGTTCAGGGCCCAT
TCACCCTCGCTGCTGGCAGCTCCGCCGCCAGTAACTGACGAAGACTTTCCGACCCTGGCTGAAGCCCACGAGCCG
TTCGATGCGCCTCAAGGCCGTTCTCCCTGCGGAAACGCCCACATGGCATACCTGCAGTGGCTCGAGTCGCAGCAG
CCACTTCTTTCGGCCCTCGAATCGACTACCCTGATAAGCTTCCAAGACTGGCTGCAGTCGCCGCTCCAACCGCTG
TCTGACAACCTAGAGTCGGCTACGTACGAGGTTTTCGAGGGCGATCCGGTCAAGTACAACCGGTACGAGGACGCC
GTCGTGGACGCCTTGAGTGACTGGAGGGAGCTTGGTCTGCCGACGTCGAAGAAGGGCGTCGTCGTCGTGGCCGTC
GCTGGCTCTGGGCGCGGGCCCCTCGTCACTCGAGCCCTGCGGGCGGCGGAGCTCACGGGCGTTGCCATCGAGGTG
TGGGCGGTAGAGAAGAACCCCAACGCATACGTCTATCTCCTGCGCCAAAACCAAACGGAATGGGGCGGTCGCGTC
AACGTGGTCAAAGCGGACATGCGGACCTGGAAGGGGCCCATTGTGAGCGAGAGAGCGGACACGGGTCCGGTCTAT
GGCAAGGTGGATGTGCTGATATCAGAGCTTCTCGGCTCTTTTGGCGACAACGAGCTGTCCCCCGAATGCCTGGAC
GGCATCCAGCACGTGCTGGCCGAGCCGCACGGCATTTCCATCCCAAGCTCCTACACGGCACACCTCAGCCCCGTT
TCGGACCCCAAGGTCTATGCCGAGATTCTAACCAGATCGGCCGTGGACGCCACGGCCTTTGACACGCCCTGGGTC
GTCCGGCTCTACGCGCTGGACTTTGTCTGTCAGCGCGTGCCGCATCACCCTCGGTTCCAGCAGGCCTGGGAGTTC
TCCCACCCGATCCCAGATTCGACACTACAGGCCATTCAATACAGGCGCTCCGGGGGCGTCGTCGGCGGTGGCGGG
GGGAGCATGGCCGGGGCGGCCGGCGCCAACGACCACAACTCGCGGTTCTGTCACTTGACCTTTGTGTGCCGCTGC
CCTGGCGTCATCCACGGGCTGGCCGGATACTTCGAGTCGACACTGTACGAGTCGAAGCTGGAGGGGGGCGAGGGG
GCGAAGGTGGAAATCAGTACGCATCCGGAGAGGATGGACAGCAAGAGCAAAGACATGGCTTCGTGGTTTCCCATC
TTCTTCCCTCTGAGAGAGCCCTTGACGTATCCCTACGACTCGGAGCTTGAGGTGAGCATGTGGCGCCAGACGGAC
GACACCAGGATCGCCACGTCTGCCCTTTGCAGCAGCCGAAAGGTGGCCTGTCTGATGTAG
Transcript >Ophio5|3065
ATGGCTTCTTCCGAAAGCTCCGCGCCGGTCGAGGGCCAAAGCCCAGGCTCTCGGCAACCCATTTTTCACATCGGC
AACCACGATTCGACCCGAGACGTTCCTCTCACTGACTTGCAATACGGCCATCTGTTGAATCAGGGTATCAGCTTT
GCGACCACGCCCATAACCAACAGCCGCTTTAAAGACAGCATCTTCAAGCTCGTTTCGGACTATATGACGTTGCTG
GACCACAACGGCGAGACTGCAACCAGCACCACCTCGGCGTCTCGGGCTGGCCCCATCCTACCTCCCCTGACCCCC
GAAGACACCGGTCTGTTCCCGTCATCGACAGTCACCACCTGCACGGCTTTTGTGAGCCCATGGATCGACCTCTGC
TCCTCGGACCCTATCATCGCCAGCGTCTCCCGCCAGGTGCTGAACCTCGAGATCAACTACGCCAATTTTTGCGGT
GTCAGGAGCATCGTCGTCACCGGGCCGCTTCGTGATGCGTGCAACGGTGGCAATCAAGGGTTGGTTCAGTTTTCT
CGTGCCGTACATGAGGCCCTGACCATTGGCAACTGCGTATCCTTCTTAATTCACATGCCCATGTACCGAGAGCCC
AACGGCATTGACTCGGTCGAAACGCTCTCATCGTTGAAGCCTCAGAAGCCTGAAATTGAGATGAAAGTGATCGAT
CTCTTCAGCTGTTGGGACTCTTGGCATCACATTCGAACGGTGTGCCGCTACAATTCAAGGCTTTTCGTTGCCCTC
AAGCTGCCCAGAATGATGCCAGAGAAGGAACTGCAGGGTCGGTGGTTTGCGGAGCCTGTTCACTTTCTCACCATA
GGGCCAGATGTCTTCCAGATCAACAGGAATGGCTACCCCTGCTTCTCCAGACACCATCAGGAGATGATATTTGCT
CACATGCGGCTCAAGGCTACGCCCTGGCTGCTTCTGTGTGACGTCGGCCCCGACGCCTCCCAGTTCAGGGCCCAT
TCACCCTCGCTGCTGGCAGCTCCGCCGCCAGTAACTGACGAAGACTTTCCGACCCTGGCTGAAGCCCACGAGCCG
TTCGATGCGCCTCAAGGCCGTTCTCCCTGCGGAAACGCCCACATGGCATACCTGCAGTGGCTCGAGTCGCAGCAG
CCACTTCTTTCGGCCCTCGAATCGACTACCCTGATAAGCTTCCAAGACTGGCTGCAGTCGCCGCTCCAACCGCTG
TCTGACAACCTAGAGTCGGCTACGTACGAGGTTTTCGAGGGCGATCCGGTCAAGTACAACCGGTACGAGGACGCC
GTCGTGGACGCCTTGAGTGACTGGAGGGAGCTTGGTCTGCCGACGTCGAAGAAGGGCGTCGTCGTCGTGGCCGTC
GCTGGCTCTGGGCGCGGGCCCCTCGTCACTCGAGCCCTGCGGGCGGCGGAGCTCACGGGCGTTGCCATCGAGGTG
TGGGCGGTAGAGAAGAACCCCAACGCATACGTCTATCTCCTGCGCCAAAACCAAACGGAATGGGGCGGTCGCGTC
AACGTGGTCAAAGCGGACATGCGGACCTGGAAGGGGCCCATTGTGAGCGAGAGAGCGGACACGGGTCCGGTCTAT
GGCAAGGTGGATGTGCTGATATCAGAGCTTCTCGGCTCTTTTGGCGACAACGAGCTGTCCCCCGAATGCCTGGAC
GGCATCCAGCACGTGCTGGCCGAGCCGCACGGCATTTCCATCCCAAGCTCCTACACGGCACACCTCAGCCCCGTT
TCGGACCCCAAGGTCTATGCCGAGATTCTAACCAGATCGGCCGTGGACGCCACGGCCTTTGACACGCCCTGGGTC
GTCCGGCTCTACGCGCTGGACTTTGTCTGTCAGCGCGTGCCGCATCACCCTCGGTTCCAGCAGGCCTGGGAGTTC
TCCCACCCGATCCCAGATTCGACACTACAGGCCATTCAATACAGGCGCTCCGGGGGCGTCGTCGGCGGTGGCGGG
GGGAGCATGGCCGGGGCGGCCGGCGCCAACGACCACAACTCGCGGTTCTGTCACTTGACCTTTGTGTGCCGCTGC
CCTGGCGTCATCCACGGGCTGGCCGGATACTTCGAGTCGACACTGTACGAGTCGAAGCTGGAGGGGGGCGAGGGG
GCGAAGGTGGAAATCAGTACGCATCCGGAGAGGATGGACAGCAAGAGCAAAGACATGGCTTCGTGGTTTCCCATC
TTCTTCCCTCTGAGAGAGCCCTTGACGTATCCCTACGACTCGGAGCTTGAGGTGAGCATGTGGCGCCAGACGGAC
GACACCAGGATCGCCACGTCTGCCCTTTGCAGCAGCCGAAAGGTGGCCTGTCTGATGTAG
Gene >Ophio5|3065
ATGGCTTCTTCCGAAAGCTCCGCGCCGGTCGAGGGCCAAAGCCCAGGCTCTCGGCAACCCATTTTTCACATCGGC
AACCACGATTCGACCCGAGACGTTCCTCTCACTGACTTGCAATACGGCCATCTGTTGAATCAGGGTGTAAGTCGC
CGTCGATGCCTTTCGCGTCTCTGGCCCGCCGTCTCTGACTCATCAACAAGATCAGCTTTGCGACCACGCCCATAA
CCAACAGCCGCTTTAAAGACAGCATCTTCAAGCTCGTTTCGGACTATATGACGTTGCTGGACCACAACGGCGAGA
CTGCAACCAGCACCACCTCGGCGTCTCGGGCTGGCCCCATCCTACCTCCCCTGACCCCCGAAGACACCGGTCTGT
TCCCGTCATCGACAGTCACCACCTGCACGGCTTTTGTGAGCCCATGGATCGACCTCTGCTCCTCGGACCCTATCA
TCGCCAGCGTCTCCCGCCAGGTGCTGAACCTCGAGATCAACTACGCCAATTTTTGCGGTGTCAGGAGCATCGTCG
TCACCGGGCCGCTTCGTGATGCGTGCAACGGTGGCAATCAAGGGTTGGTTCAGTTTTCTCGTGCCGTACATGAGG
CCCTGACCATTGGCAACTGCGTATCCTTCTTAATTCACATGCCCATGTACCGAGAGCCCAACGGCATTGACTCGG
TCGAAACGCTCTCATCGTTGAAGCCTCAGAAGCCTGAAATTGAGATGAAAGTGATCGATCTCTTCAGCTGTTGGG
ACTCTTGGCATCACATTCGAACGGTGTGCCGCTACAATTCAAGGCTTTTCGTTGGTGAGCAGAAAGCCACCTCCG
CACGTTTTCCATCAGTGCTGACGGCAGTTCCGCCACATCTAGCCCTCAAGCTGCCCAGAATGATGCCAGAGAAGG
AACTGCAGGGTCGGTGGTTTGCGGAGCCTGTTCACTTTCTCACCATAGGGCCAGATGTCTTCCAGATCAACAGGA
ATGGCTACCCCTGCTTCTCCAGACACCATCAGGAGATGATATTTGCTCACATGCGGCTCAAGGCTACGCCCTGGC
TGCTTCTGTGTGACGTCGGCCCCGACGCCTCCCAGTTCAGGGCCCATTCACCCTCGCTGCTGGCAGCTCCGCCGC
CAGTAACTGACGAAGACTTTCCGACCCTGGCTGAAGCCCACGAGCCGTTCGATGCGCCTCAAGGCCGTTCTCCCT
GCGGAAACGCCCACATGGCATACCTGCAGTGGCTCGAGTCGCAGCAGCCACTTCTTTCGGCCCTCGAATCGACTA
CCCTGATAAGCTTCCAAGACTGGCTGCAGTCGCCGCTCCAACCGCTGTCTGACAACCTAGAGTCGGCTACGTACG
AGGTTTTCGAGGGCGATCCGGTCAAGTACAACCGGTACGAGGACGCCGTCGTGGACGCCTTGAGTGACTGGAGGG
AGCTTGGTCTGCCGACGTCGAAGAAGGGCGTCGTCGTCGTGGCCGTCGCTGGCTCTGGGCGCGGGCCCCTCGTCA
CTCGAGCCCTGCGGGCGGCGGAGCTCACGGGCGTTGCCATCGAGGTGTGGGCGGTAGAGAAGAACCCCAACGCAT
ACGTCTATCTCCTGCGCCAAAACCAAACGGAATGGGGCGGTCGCGTCAACGTGGTCAAAGCGGACATGCGGACCT
GGAAGGGGCCCATTGTGAGCGAGAGAGCGGACACGGGTCCGGTCTATGGCAAGGTGGATGTGCTGATATCAGAGC
TTCTCGGCTCTTTTGGCGACAACGAGCTGTCCCCCGAATGCCTGGACGGCATCCAGCACGTGCTGGCCGAGCCGC
ACGGCATTTCCATCCCAAGCTCCTACACGGCACACCTCAGCCCCGTTTCGGACCCCAAGGTCTATGCCGAGATTC
TAACCAGATCGGCCGTGGACGCCACGGCCTTTGACACGCCCTGGGTCGTCCGGCTCTACGCGCTGGACTTTGTCT
GTCAGCGCGTGCCGCATCACCCTCGGTTCCAGCAGGCCTGGGAGTTCTCCCACCCGATCCCAGATTCGACACTAC
AGGCCATTCAATACAGGCGCTCCGGGGGCGTCGTCGGCGGTGGCGGGGGGAGCATGGCCGGGGCGGCCGGCGCCA
ACGACCACAACTCGCGGTTCTGTCACTTGACCTTTGTGTGCCGCTGCCCTGGCGTCATCCACGGGCTGGCCGGAT
ACTTCGAGTCGACACTGTACGAGTCGAAGCTGGAGGGGGGCGAGGGGGCGAAGGTGGAAATCAGTACGCATCCGG
AGAGGATGGACAGCAAGAGCAAAGACATGGCTTCGTGGTTTCCCATCTTCTTCCCTCTGAGAGTGAGTGAAAGCG
TTCGTGATCCTGTGGATGGCGATGATGACTAACTGAGTGCTACGCAGGAGCCCTTGACGTATCCCTACGACTCGG
AGCTTGAGGTGAGCATGTGGCGCCAGACGGACGACACCAGGGTATGGTACGAATGGATGGTGGAGGCTTGGACGT
GGATAAGCCCTACTAAACGTATCAAGATCGCCACGTCTGCCCTTTGCAGCAGCCGAAAGGTGGCCTGTCTGATGT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail