Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3061
Gene name
Locationscaffold_243:4090..5200
Strand-
Gene length (bp)1110
Transcript length (bp)1110
Coding sequence length (bp)1107
Protein length (aa) 369

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P87170|DGK1_SCHPO CTP-dependent diacylglycerol kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptp4 PE=3 SV=1 125 359 8.0E-54
sp|Q12382|DGK1_YEAST CTP-dependent diacylglycerol kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DGK1 PE=1 SV=1 122 368 1.0E-52
sp|Q753I3|DGK1_ASHGO CTP-dependent diacylglycerol kinase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DGK1 PE=3 SV=1 128 359 3.0E-52

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 138 160 22
2 201 218 17
3 259 281 22
4 351 368 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3061
MSLRRKSAVPRTPRVISPSPTPSDQDAQEYFGPTTRSAFRKRLSTSQTLEERSEDDSPPGPRRSRTRSRSPMKQM
DNSTGHFSAAQPATNGHLAPPQPSTFGGWSWRDFSRSPSPLGLIPIHRHWRTFVHKHEVPRKALHVSIGFFVAWL
YAVGTRVDAVPPYLMTALLPIATVDWLRHRYESVNRLYVRLLGALMRESEYSGWNGVIFYLLGAWIVLRFFPKDV
GVMSVLLLSWCDSAASTFGRLWGRYTPRIRRGKSLAGSAAAFLVGVGTSYFFYAWLVPTFGPMPGDEGFMFKGTL
SLPEPARAALGLADRAGRVSGALALGLVSLWSGLVASASEVVDMFGWDDNLTIPVLSGVGIMGFLKVFG
Coding >Ophio5|3061
ATGTCGCTGCGGCGCAAGTCTGCCGTACCCCGGACGCCTCGCGTCATATCACCGAGTCCTACGCCTTCGGACCAG
GATGCCCAGGAGTACTTTGGTCCCACCACGCGGTCGGCTTTTCGGAAACGCCTCTCGACCTCGCAGACGCTCGAG
GAGCGAAGCGAGGATGATAGCCCGCCGGGGCCCCGGAGATCCCGCACGAGAAGTCGATCGCCTATGAAGCAGATG
GACAACTCAACTGGCCACTTCTCCGCCGCTCAGCCAGCAACAAACGGCCATCTCGCCCCCCCGCAACCATCTACG
TTCGGCGGCTGGTCGTGGCGCGACTTTAGTCGCAGCCCGAGCCCGCTGGGCCTCATTCCCATCCACCGCCACTGG
CGGACCTTTGTGCACAAGCACGAGGTGCCACGCAAGGCGCTGCACGTATCCATCGGCTTCTTCGTCGCCTGGCTC
TACGCCGTCGGTACGCGCGTCGATGCCGTGCCACCATACCTCATGACGGCGCTGTTGCCCATCGCCACGGTAGAC
TGGCTGCGACACCGCTACGAGTCCGTCAACAGGCTGTACGTCAGGCTCCTCGGCGCCCTCATGCGCGAGAGTGAG
TACTCGGGTTGGAATGGCGTCATCTTCTACCTCCTCGGCGCATGGATCGTCCTACGCTTCTTTCCCAAGGACGTC
GGTGTCATGAGTGTCCTGCTCCTCAGCTGGTGCGACTCCGCCGCCAGCACTTTCGGTCGCCTCTGGGGACGGTAC
ACGCCGAGGATCCGCCGCGGCAAGTCGCTGGCCGGATCGGCGGCTGCCTTCCTCGTCGGCGTCGGCACCTCCTAC
TTCTTCTACGCATGGCTCGTGCCGACCTTTGGGCCCATGCCGGGCGACGAAGGCTTCATGTTCAAGGGCACCTTG
TCGCTACCGGAGCCGGCCCGGGCGGCGTTGGGGCTGGCCGACCGAGCGGGCCGAGTCTCGGGCGCCCTGGCACTC
GGACTCGTGAGCTTGTGGTCCGGGCTGGTGGCGTCGGCCAGCGAAGTGGTCGACATGTTTGGCTGGGATGACAAC
CTCACGATACCGGTGCTCAGCGGCGTCGGCATCATGGGCTTTCTCAAGGTCTTCGGC
Transcript >Ophio5|3061
ATGTCGCTGCGGCGCAAGTCTGCCGTACCCCGGACGCCTCGCGTCATATCACCGAGTCCTACGCCTTCGGACCAG
GATGCCCAGGAGTACTTTGGTCCCACCACGCGGTCGGCTTTTCGGAAACGCCTCTCGACCTCGCAGACGCTCGAG
GAGCGAAGCGAGGATGATAGCCCGCCGGGGCCCCGGAGATCCCGCACGAGAAGTCGATCGCCTATGAAGCAGATG
GACAACTCAACTGGCCACTTCTCCGCCGCTCAGCCAGCAACAAACGGCCATCTCGCCCCCCCGCAACCATCTACG
TTCGGCGGCTGGTCGTGGCGCGACTTTAGTCGCAGCCCGAGCCCGCTGGGCCTCATTCCCATCCACCGCCACTGG
CGGACCTTTGTGCACAAGCACGAGGTGCCACGCAAGGCGCTGCACGTATCCATCGGCTTCTTCGTCGCCTGGCTC
TACGCCGTCGGTACGCGCGTCGATGCCGTGCCACCATACCTCATGACGGCGCTGTTGCCCATCGCCACGGTAGAC
TGGCTGCGACACCGCTACGAGTCCGTCAACAGGCTGTACGTCAGGCTCCTCGGCGCCCTCATGCGCGAGAGTGAG
TACTCGGGTTGGAATGGCGTCATCTTCTACCTCCTCGGCGCATGGATCGTCCTACGCTTCTTTCCCAAGGACGTC
GGTGTCATGAGTGTCCTGCTCCTCAGCTGGTGCGACTCCGCCGCCAGCACTTTCGGTCGCCTCTGGGGACGGTAC
ACGCCGAGGATCCGCCGCGGCAAGTCGCTGGCCGGATCGGCGGCTGCCTTCCTCGTCGGCGTCGGCACCTCCTAC
TTCTTCTACGCATGGCTCGTGCCGACCTTTGGGCCCATGCCGGGCGACGAAGGCTTCATGTTCAAGGGCACCTTG
TCGCTACCGGAGCCGGCCCGGGCGGCGTTGGGGCTGGCCGACCGAGCGGGCCGAGTCTCGGGCGCCCTGGCACTC
GGACTCGTGAGCTTGTGGTCCGGGCTGGTGGCGTCGGCCAGCGAAGTGGTCGACATGTTTGGCTGGGATGACAAC
CTCACGATACCGGTGCTCAGCGGCGTCGGCATCATGGGCTTTCTCAAGGTCTTCGGCTGA
Gene >Ophio5|3061
ATGTCGCTGCGGCGCAAGTCTGCCGTACCCCGGACGCCTCGCGTCATATCACCGAGTCCTACGCCTTCGGACCAG
GATGCCCAGGAGTACTTTGGTCCCACCACGCGGTCGGCTTTTCGGAAACGCCTCTCGACCTCGCAGACGCTCGAG
GAGCGAAGCGAGGATGATAGCCCGCCGGGGCCCCGGAGATCCCGCACGAGAAGTCGATCGCCTATGAAGCAGATG
GACAACTCAACTGGCCACTTCTCCGCCGCTCAGCCAGCAACAAACGGCCATCTCGCCCCCCCGCAACCATCTACG
TTCGGCGGCTGGTCGTGGCGCGACTTTAGTCGCAGCCCGAGCCCGCTGGGCCTCATTCCCATCCACCGCCACTGG
CGGACCTTTGTGCACAAGCACGAGGTGCCACGCAAGGCGCTGCACGTATCCATCGGCTTCTTCGTCGCCTGGCTC
TACGCCGTCGGTACGCGCGTCGATGCCGTGCCACCATACCTCATGACGGCGCTGTTGCCCATCGCCACGGTAGAC
TGGCTGCGACACCGCTACGAGTCCGTCAACAGGCTGTACGTCAGGCTCCTCGGCGCCCTCATGCGCGAGAGTGAG
TACTCGGGTTGGAATGGCGTCATCTTCTACCTCCTCGGCGCATGGATCGTCCTACGCTTCTTTCCCAAGGACGTC
GGTGTCATGAGTGTCCTGCTCCTCAGCTGGTGCGACTCCGCCGCCAGCACTTTCGGTCGCCTCTGGGGACGGTAC
ACGCCGAGGATCCGCCGCGGCAAGTCGCTGGCCGGATCGGCGGCTGCCTTCCTCGTCGGCGTCGGCACCTCCTAC
TTCTTCTACGCATGGCTCGTGCCGACCTTTGGGCCCATGCCGGGCGACGAAGGCTTCATGTTCAAGGGCACCTTG
TCGCTACCGGAGCCGGCCCGGGCGGCGTTGGGGCTGGCCGACCGAGCGGGCCGAGTCTCGGGCGCCCTGGCACTC
GGACTCGTGAGCTTGTGGTCCGGGCTGGTGGCGTCGGCCAGCGAAGTGGTCGACATGTTTGGCTGGGATGACAAC
CTCACGATACCGGTGCTCAGCGGCGTCGGCATCATGGGCTTTCTCAAGGTCTTCGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail