Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3057
Gene name
Locationscaffold_242:18869..27289
Strand+
Gene length (bp)8420
Transcript length (bp)8115
Coding sequence length (bp)8112
Protein length (aa) 2704

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 5.5E-30 2237 2353
PF00072 Response_reg Response regulator receiver domain 1.2E-19 2404 2523
PF00512 HisKA His Kinase A (phospho-acceptor) domain 3.6E-17 2123 2186
PF13185 GAF_2 GAF domain 1.9E-12 1918 2063
PF13191 AAA_16 AAA ATPase domain 1.7E-12 702 909
PF01590 GAF GAF domain 1.1E-06 1919 2063

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q86CZ2|DHKK_DICDI Hybrid signal transduction histidine kinase K OS=Dictyostelium discoideum GN=dhkK PE=1 SV=1 2099 2534 1.0E-63
sp|Q9P896|TCSA_EMENI Two-component system protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsA PE=3 SV=2 2088 2523 5.0E-63
sp|Q9KLK7|LUXQ_VIBCH Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=luxQ PE=1 SV=1 2049 2526 2.0E-58
sp|Q7MD16|LUXQ_VIBVY Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain YJ016) GN=luxQ PE=3 SV=1 2075 2523 5.0E-54
sp|Q8D5Z6|LUXQ_VIBVU Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain CMCP6) GN=luxQ PE=3 SV=1 2075 2523 6.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q86CZ2|DHKK_DICDI Hybrid signal transduction histidine kinase K OS=Dictyostelium discoideum GN=dhkK PE=1 SV=1 2099 2534 1.0E-63
sp|Q9P896|TCSA_EMENI Two-component system protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsA PE=3 SV=2 2088 2523 5.0E-63
sp|Q9KLK7|LUXQ_VIBCH Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=luxQ PE=1 SV=1 2049 2526 2.0E-58
sp|Q7MD16|LUXQ_VIBVY Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain YJ016) GN=luxQ PE=3 SV=1 2075 2523 5.0E-54
sp|Q8D5Z6|LUXQ_VIBVU Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain CMCP6) GN=luxQ PE=3 SV=1 2075 2523 6.0E-54
sp|Q87GU5|LUXQ_VIBPA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=luxQ PE=3 SV=1 2085 2534 2.0E-52
sp|P54302|LUXQ_VIBHA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio harveyi GN=luxQ PE=1 SV=1 2085 2534 3.0E-51
sp|P0AEC5|BARA_ECOLI Signal transduction histidine-protein kinase BarA OS=Escherichia coli (strain K12) GN=barA PE=1 SV=1 2092 2353 3.0E-50
sp|P0AEC6|BARA_ECOL6 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=barA PE=1 SV=1 2092 2353 3.0E-50
sp|P0AEC7|BARA_ECO57 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O157:H7 GN=barA PE=3 SV=1 2092 2353 3.0E-50
sp|P59342|BARA_SHIFL Signal transduction histidine-protein kinase BarA OS=Shigella flexneri GN=barA PE=3 SV=1 2092 2353 3.0E-50
sp|P0C0F7|RPFC_XANC8 Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpfC PE=3 SV=2 2111 2533 5.0E-50
sp|P0C0F6|RPFC_XANCP Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpfC PE=1 SV=2 2111 2533 6.0E-50
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 2099 2522 2.0E-49
sp|P48027|GACS_PSESY Sensor protein GacS OS=Pseudomonas syringae pv. syringae GN=gacS PE=3 SV=1 2103 2358 3.0E-49
sp|Q869S5|DOKA_DICDI Hybrid signal transduction protein dokA OS=Dictyostelium discoideum GN=dokA PE=1 SV=1 2116 2350 1.0E-47
sp|Q54U87|DHKA_DICDI Hybrid signal transduction histidine kinase A OS=Dictyostelium discoideum GN=dhkA PE=1 SV=1 2116 2405 8.0E-47
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase B OS=Dictyostelium discoideum GN=dhkB PE=1 SV=1 2108 2350 2.0E-46
sp|O81122|ETR1_MALDO Ethylene receptor OS=Malus domestica GN=ETR1 PE=2 SV=1 2093 2523 8.0E-46
sp|Q9ZWL6|ETR1_PASED Ethylene receptor OS=Passiflora edulis GN=ETR1 PE=2 SV=1 2093 2523 6.0E-45
sp|Q9XH58|ETR1_PELHO Ethylene receptor 1 OS=Pelargonium hortorum GN=ETR1 PE=2 SV=1 2093 2523 1.0E-44
sp|Q5AHA0|CHK1_CANAL Histidine protein kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHK1 PE=2 SV=1 2004 2523 1.0E-44
sp|P49333|ETR1_ARATH Ethylene receptor 1 OS=Arabidopsis thaliana GN=ETR1 PE=1 SV=1 2093 2523 1.0E-44
sp|Q3S4A7|AHK5_ARATH Histidine kinase 5 OS=Arabidopsis thaliana GN=AHK5 PE=1 SV=1 2060 2392 1.0E-44
sp|O82436|ETR1_CUCMN Ethylene receptor 1 OS=Cucumis melo var. cantalupensis GN=ETR1 PE=2 SV=1 2093 2534 2.0E-44
sp|Q41342|ETR1_SOLLC Ethylene receptor 1 OS=Solanum lycopersicum GN=ETR1 PE=1 SV=1 2093 2523 3.0E-44
sp|O48929|ETR1_TOBAC Ethylene receptor OS=Nicotiana tabacum GN=ETR1 PE=2 SV=1 2093 2523 4.0E-44
sp|O49230|ETR1_BRAOL Ethylene receptor 1 OS=Brassica oleracea GN=ETR1 PE=2 SV=1 2093 2523 6.0E-44
sp|Q9XH57|ETR2_PELHO Ethylene receptor 2 OS=Pelargonium hortorum GN=ETR2 PE=2 SV=1 2093 2523 1.0E-43
sp|Q9HUI3|ARUS_PSEAE Sensor histidine kinase AruS OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruS PE=3 SV=1 2107 2523 1.0E-43
sp|Q9M7M1|ETR1_PRUPE Ethylene receptor OS=Prunus persica GN=ETR1 PE=2 SV=1 2093 2523 3.0E-43
sp|P58662|RCSC_SALTY Sensor histidine kinase RcsC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rcsC PE=3 SV=1 2049 2344 3.0E-43
sp|Q56128|RCSC_SALTI Sensor histidine kinase RcsC OS=Salmonella typhi GN=rcsC PE=3 SV=2 2049 2344 4.0E-43
sp|Q9SSY6|ETR1_CUCSA Ethylene receptor 1 OS=Cucumis sativus GN=ETR1 PE=2 SV=1 2093 2534 5.0E-43
sp|Q5A599|NIK1_CANAL Histidine protein kinase NIK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIK1 PE=1 SV=2 2116 2350 7.0E-43
sp|P0DMC6|RCSC_ECOLX Sensor histidine kinase RcsC OS=Escherichia coli GN=rcsC PE=1 SV=1 2063 2350 8.0E-43
sp|P0DMC5|RCSC_ECOLI Sensor histidine kinase RcsC OS=Escherichia coli (strain K12) GN=rcsC PE=1 SV=1 2063 2350 9.0E-43
sp|O49187|ETR2_SOLLC Ethylene receptor 2 OS=Solanum lycopersicum GN=ETR2 PE=2 SV=1 2093 2523 6.0E-42
sp|Q54RP6|DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum GN=dhkL PE=3 SV=1 2127 2354 1.0E-41
sp|Q551X9|DHKF_DICDI Hybrid signal transduction histidine kinase F OS=Dictyostelium discoideum GN=dhkF PE=3 SV=1 2103 2384 1.0E-40
sp|Q54Q69|DHKG_DICDI Hybrid signal transduction histidine kinase G OS=Dictyostelium discoideum GN=dhkG PE=3 SV=1 1974 2355 3.0E-39
sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 2104 2360 4.0E-39
sp|P30855|EVGS_ECOLI Sensor protein EvgS OS=Escherichia coli (strain K12) GN=evgS PE=1 SV=2 2088 2523 2.0E-38
sp|P58402|EVGS_ECO57 Sensor protein EvgS OS=Escherichia coli O157:H7 GN=evgS PE=3 SV=1 2088 2523 7.0E-38
sp|Q9P4U6|TCSB_EMENI Two-component system protein B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsB PE=1 SV=2 2116 2536 1.0E-37
sp|P0AEC4|ARCB_SHIFL Aerobic respiration control sensor protein ArcB OS=Shigella flexneri GN=arcB PE=3 SV=1 2107 2514 2.0E-37
sp|P0AEC3|ARCB_ECOLI Aerobic respiration control sensor protein ArcB OS=Escherichia coli (strain K12) GN=arcB PE=1 SV=1 2107 2514 2.0E-37
sp|P58363|ARCB_ECO57 Aerobic respiration control sensor protein ArcB OS=Escherichia coli O157:H7 GN=arcB PE=3 SV=1 2107 2514 2.0E-37
sp|P39453|TORS_ECOLI Sensor protein TorS OS=Escherichia coli (strain K12) GN=torS PE=1 SV=4 2096 2527 4.0E-36
sp|P16575|BVGS_BORPE Virulence sensor protein BvgS OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=bvgS PE=1 SV=3 2107 2530 4.0E-36
sp|P58356|TORS_ECO57 Sensor protein TorS OS=Escherichia coli O157:H7 GN=torS PE=3 SV=1 2096 2527 7.0E-36
sp|A3BE68|OHK1_ORYSJ Probable histidine kinase 1 OS=Oryza sativa subsp. japonica GN=HK1 PE=2 SV=1 2061 2350 2.0E-35
sp|A2YFR6|OHK1_ORYSI Probable histidine kinase 1 OS=Oryza sativa subsp. indica GN=HK1 PE=3 SV=1 2061 2350 2.0E-35
sp|Q9C5U2|AHK2_ARATH Histidine kinase 2 OS=Arabidopsis thaliana GN=AHK2 PE=1 SV=1 2097 2360 3.0E-35
sp|P26762|BVGS_BORBR Virulence sensor protein BvgS OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=bvgS PE=3 SV=2 2116 2524 6.0E-35
sp|P40330|BVGS_BORPA Virulence sensor protein BvgS OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=bvgS PE=3 SV=2 2116 2524 1.0E-34
sp|Q9C5U1|AHK3_ARATH Histidine kinase 3 OS=Arabidopsis thaliana GN=AHK3 PE=1 SV=1 2108 2519 2.0E-34
sp|A1A697|OHK5_ORYSJ Probable histidine kinase 5 OS=Oryza sativa subsp. japonica GN=HK5 PE=2 SV=1 2116 2358 3.0E-34
sp|A1A696|OHK3_ORYSJ Probable histidine kinase 3 OS=Oryza sativa subsp. japonica GN=HK3 PE=2 SV=1 2114 2355 2.0E-33
sp|A2WYI4|OHK3_ORYSI Probable histidine kinase 3 OS=Oryza sativa subsp. indica GN=HK3 PE=2 SV=1 2114 2355 2.0E-33
sp|O74539|MAK3_SCHPO Peroxide stress-activated histidine kinase mak3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak3 PE=1 SV=1 709 1321 3.0E-32
sp|Q53RH0|ERS1_ORYSJ Probable ethylene response sensor 1 OS=Oryza sativa subsp. japonica GN=ERS1 PE=2 SV=1 2093 2352 3.0E-32
sp|A2XL32|ERS1_ORYSI Probable ethylene response sensor 1 OS=Oryza sativa subsp. indica GN=ERS1 PE=2 SV=1 2093 2352 3.0E-32
sp|Q9P7Q7|MAK1_SCHPO Peroxide stress-activated histidine kinase mak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak1 PE=3 SV=1 2094 2357 3.0E-32
sp|P37894|PLEC_CAUCR Non-motile and phage-resistance protein OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pleC PE=1 SV=2 2116 2350 3.0E-31
sp|Q95PI2|DHKC_DICDI Hybrid signal transduction histidine kinase C OS=Dictyostelium discoideum GN=dhkC PE=1 SV=1 2117 2353 8.0E-31
sp|Q52969|Y1002_RHIME Uncharacterized sensor-like histidine kinase R01002 OS=Rhizobium meliloti (strain 1021) GN=R01002 PE=3 SV=2 2122 2350 6.0E-30
sp|O74539|MAK3_SCHPO Peroxide stress-activated histidine kinase mak3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak3 PE=1 SV=1 349 566 5.0E-28
sp|A5A2P0|WALK_STASR Sensor protein kinase WalK (Fragment) OS=Staphylococcus sciuri subsp. rodentium GN=walK PE=3 SV=1 2126 2364 6.0E-28
sp|P23545|PHOR_BACSU Alkaline phosphatase synthesis sensor protein PhoR OS=Bacillus subtilis (strain 168) GN=phoR PE=1 SV=1 2126 2355 1.0E-27
sp|Q0DKM0|ERS2_ORYSJ Probable ethylene response sensor 2 OS=Oryza sativa subsp. japonica GN=ERS2 PE=2 SV=1 2093 2359 1.0E-27
sp|B8AY75|ERS2_ORYSI Probable ethylene response sensor 2 OS=Oryza sativa subsp. indica GN=ERS2 PE=2 SV=1 2093 2359 2.0E-27
sp|Q9SXL4|AHK1_ARATH Histidine kinase 1 OS=Arabidopsis thaliana GN=AHK1 PE=1 SV=2 2116 2344 3.0E-27
sp|P44578|ARCB_HAEIN Aerobic respiration control sensor protein ArcB homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=arcB PE=3 SV=1 2072 2332 9.0E-27
sp|P35164|RESE_BACSU Sensor histidine kinase ResE OS=Bacillus subtilis (strain 168) GN=resE PE=1 SV=1 2077 2350 8.0E-26
sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 224 539 9.0E-26
sp|Q03228|DIVJ_CAUCR Histidine protein kinase DivJ OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=divJ PE=1 SV=2 2116 2345 9.0E-26
sp|E0X9C7|TODS_PSEPT Sensor histidine kinase TodS OS=Pseudomonas putida (strain DOT-T1E) GN=todS PE=1 SV=1 2094 2528 1.0E-25
sp|A5W4E3|TODS_PSEP1 Sensor histidine kinase TodS OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todS PE=1 SV=1 2094 2528 1.0E-25
sp|Q8KIY1|TMOS_PSEME Sensor histidine kinase TmoS OS=Pseudomonas mendocina GN=tmoS PE=1 SV=1 2094 2528 7.0E-25
sp|A1A698|OHK4_ORYSJ Probable histidine kinase 4 OS=Oryza sativa subsp. japonica GN=HK4 PE=2 SV=1 2114 2306 1.0E-24
sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 707 1767 2.0E-24
sp|Q38846|ERS1_ARATH Ethylene response sensor 1 OS=Arabidopsis thaliana GN=ERS1 PE=1 SV=1 2048 2350 2.0E-24
sp|Q9RDT3|WALK_STAAU Sensor protein kinase WalK (Fragment) OS=Staphylococcus aureus GN=walK PE=1 SV=1 2112 2353 2.0E-24
sp|A1A699|OHK6_ORYSJ Probable histidine kinase 6 OS=Oryza sativa subsp. japonica GN=HK6 PE=1 SV=1 2116 2264 3.0E-24
sp|Q6GKS6|WALK_STAAR Sensor protein kinase WalK OS=Staphylococcus aureus (strain MRSA252) GN=walK PE=3 SV=1 2112 2353 1.0E-23
sp|Q7A215|WALK_STAAW Sensor protein kinase WalK OS=Staphylococcus aureus (strain MW2) GN=walK PE=3 SV=1 2112 2353 1.0E-23
sp|A8YYU2|WALK_STAAT Sensor protein kinase WalK OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=walK PE=3 SV=1 2112 2353 1.0E-23
sp|Q6GD71|WALK_STAAS Sensor protein kinase WalK OS=Staphylococcus aureus (strain MSSA476) GN=walK PE=3 SV=1 2112 2353 1.0E-23
sp|Q7A8E0|WALK_STAAN Sensor protein kinase WalK OS=Staphylococcus aureus (strain N315) GN=walK PE=1 SV=1 2112 2353 1.0E-23
sp|Q7A305|WALK_STAAM Sensor protein kinase WalK OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=walK PE=3 SV=1 2112 2353 1.0E-23
sp|A6QD58|WALK_STAAE Sensor protein kinase WalK OS=Staphylococcus aureus (strain Newman) GN=walK PE=3 SV=1 2112 2353 1.0E-23
sp|Q5HJX6|WALK_STAAC Sensor protein kinase WalK OS=Staphylococcus aureus (strain COL) GN=walK PE=3 SV=1 2112 2353 1.0E-23
sp|Q2YUQ2|WALK_STAAB Sensor protein kinase WalK OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=walK PE=3 SV=1 2112 2353 1.0E-23
sp|A5INR0|WALK_STAA9 Sensor protein kinase WalK OS=Staphylococcus aureus (strain JH9) GN=walK PE=3 SV=1 2112 2353 1.0E-23
sp|Q2G2U4|WALK_STAA8 Sensor protein kinase WalK OS=Staphylococcus aureus (strain NCTC 8325) GN=walK PE=1 SV=1 2112 2353 1.0E-23
sp|Q2FKN7|WALK_STAA3 Sensor protein kinase WalK OS=Staphylococcus aureus (strain USA300) GN=walK PE=3 SV=1 2112 2353 1.0E-23
sp|A6TXG9|WALK_STAA2 Sensor protein kinase WalK OS=Staphylococcus aureus (strain JH1) GN=walK PE=3 SV=1 2112 2353 1.0E-23
sp|A7WWQ7|WALK_STAA1 Sensor protein kinase WalK OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=walK PE=3 SV=1 2112 2353 1.0E-23
sp|Q9ZTP3|EIN4_ARATH Protein EIN4 OS=Arabidopsis thaliana GN=EIN4 PE=1 SV=1 2046 2530 2.0E-22
sp|Q8CU87|WALK_STAES Sensor protein kinase WalK OS=Staphylococcus epidermidis (strain ATCC 12228) GN=walK PE=1 SV=1 2112 2353 3.0E-22
sp|Q5HK19|WALK_STAEQ Sensor protein kinase WalK OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=walK PE=1 SV=1 2112 2353 3.0E-22
sp|Q4A159|WALK_STAS1 Sensor protein kinase WalK OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=walK PE=3 SV=1 2112 2353 4.0E-22
sp|Q55E44|DHKE_DICDI Hybrid signal transduction histidine kinase E OS=Dictyostelium discoideum GN=dhkE PE=3 SV=1 2098 2268 4.0E-22
sp|Q4LAJ8|WALK_STAHJ Sensor protein kinase WalK OS=Staphylococcus haemolyticus (strain JCSC1435) GN=walK PE=3 SV=1 2112 2353 5.0E-22
sp|P20169|DSPA_SYNY3 Drug sensory protein A OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dspA PE=3 SV=2 2118 2351 5.0E-22
sp|Q45614|YYCG_BACSU Sensor histidine kinase YycG OS=Bacillus subtilis (strain 168) GN=yycG PE=1 SV=1 2112 2358 5.0E-22
sp|Q54SP4|DHKD_DICDI Hybrid signal transduction histidine kinase D OS=Dictyostelium discoideum GN=dhkD PE=2 SV=1 2097 2328 1.0E-21
sp|A9M715|PDHS_BRUC2 Cell-division control histidine kinase PdhS OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=pdhS PE=3 SV=1 2090 2327 1.0E-21
sp|Q9C5U0|AHK4_ARATH Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 PE=1 SV=1 2116 2268 2.0E-21
sp|A6X5X4|PDHS_OCHA4 Cell-division control histidine kinase PdhS OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=pdhS PE=3 SV=1 2090 2352 2.0E-21
sp|B0CI82|PDHS_BRUSI Cell-division control histidine kinase PdhS OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=pdhS PE=3 SV=1 2090 2358 2.0E-21
sp|Q8FZ86|PDHS_BRUSU Cell-division control histidine kinase PdhS OS=Brucella suis biovar 1 (strain 1330) GN=pdhS PE=3 SV=1 2090 2358 2.0E-21
sp|Q8YIM6|PDHS_BRUME Cell-division control histidine kinase PdhS OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pdhS PE=3 SV=2 2090 2358 3.0E-21
sp|Q57BR6|PDHS_BRUAB Cell-division control histidine kinase PdhS OS=Brucella abortus biovar 1 (strain 9-941) GN=pdhS PE=1 SV=1 2090 2358 3.0E-21
sp|Q2YRB4|PDHS_BRUA2 Cell-division control histidine kinase PdhS OS=Brucella abortus (strain 2308) GN=pdhS PE=3 SV=1 2090 2358 3.0E-21
sp|B2S758|PDHS_BRUA1 Cell-division control histidine kinase PdhS OS=Brucella abortus (strain S19) GN=pdhS PE=3 SV=1 2090 2358 3.0E-21
sp|A5VRX4|PDHS_BRUO2 Cell-division control histidine kinase PdhS OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=pdhS PE=3 SV=1 2090 2327 4.0E-21
sp|O74539|MAK3_SCHPO Peroxide stress-activated histidine kinase mak3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak3 PE=1 SV=1 2116 2329 9.0E-21
sp|Q5A599|NIK1_CANAL Histidine protein kinase NIK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIK1 PE=1 SV=2 2372 2540 1.0E-20
sp|Q54SP4|DHKD_DICDI Hybrid signal transduction histidine kinase D OS=Dictyostelium discoideum GN=dhkD PE=2 SV=1 2075 2350 2.0E-20
sp|Q54W36|DHKH_DICDI Hybrid signal transduction histidine kinase H OS=Dictyostelium discoideum GN=dhkH PE=3 SV=1 2117 2272 9.0E-20
sp|Q1XD95|YCF26_PYRYE Uncharacterized sensor-like histidine kinase ycf26 OS=Pyropia yezoensis GN=ycf26 PE=3 SV=1 2118 2354 1.0E-19
sp|P94414|YCLK_BACSU Sensor histidine kinase YclK OS=Bacillus subtilis (strain 168) GN=yclK PE=3 SV=1 2117 2344 7.0E-19
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 2404 2527 9.0E-19
sp|Q55168|PHY1_SYNY3 Phytochrome-like protein cph1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cph1 PE=1 SV=1 2065 2350 3.0E-18
sp|Q6GGK7|SRRB_STAAR Sensor protein SrrB OS=Staphylococcus aureus (strain MRSA252) GN=srrB PE=3 SV=2 2121 2345 6.0E-18
sp|Q9CCJ1|MTRB_MYCLE Sensor histidine kinase MtrB OS=Mycobacterium leprae (strain TN) GN=mtrB PE=3 SV=1 2104 2322 6.0E-18
sp|Q7A5H7|SRRB_STAAN Sensor protein SrrB OS=Staphylococcus aureus (strain N315) GN=srrB PE=1 SV=2 2121 2345 6.0E-18
sp|Q99TZ9|SRRB_STAAM Sensor protein SrrB OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=srrB PE=3 SV=2 2121 2345 6.0E-18
sp|Q8NWF3|SRRB_STAAW Sensor protein SrrB OS=Staphylococcus aureus (strain MW2) GN=srrB PE=3 SV=2 2121 2345 9.0E-18
sp|Q9L523|SRRB_STAAU Sensor protein SrrB OS=Staphylococcus aureus GN=srrB PE=2 SV=1 2121 2345 9.0E-18
sp|Q6G973|SRRB_STAAS Sensor protein SrrB OS=Staphylococcus aureus (strain MSSA476) GN=srrB PE=3 SV=2 2121 2345 9.0E-18
sp|Q5HFT1|SRRB_STAAC Sensor protein SrrB OS=Staphylococcus aureus (strain COL) GN=srrB PE=2 SV=1 2121 2345 9.0E-18
sp|Q2FY80|SRRB_STAA8 Sensor protein SrrB OS=Staphylococcus aureus (strain NCTC 8325) GN=srrB PE=3 SV=1 2121 2345 9.0E-18
sp|Q9RQQ9|DIVL_CAUCR Sensor protein DivL OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=divL PE=1 SV=2 2107 2345 2.0E-17
sp|Q9LCC2|PHYA_NOSS1 Cyanobacterial phytochrome A OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=aphA PE=3 SV=1 2131 2350 3.0E-17
sp|P9WGK9|MTRB_MYCTU Sensor histidine kinase MtrB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mtrB PE=1 SV=1 2111 2322 6.0E-17
sp|P9WGK8|MTRB_MYCTO Sensor histidine kinase MtrB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mtrB PE=3 SV=1 2111 2322 6.0E-17
sp|P59963|MTRB_MYCBO Sensor histidine kinase MtrB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mtrB PE=3 SV=1 2111 2322 6.0E-17
sp|Q9SXL4|AHK1_ARATH Histidine kinase 1 OS=Arabidopsis thaliana GN=AHK1 PE=1 SV=2 2396 2514 2.0E-16
sp|Q840P7|SAES_STAAE Histidine protein kinase SaeS OS=Staphylococcus aureus (strain Newman) GN=saeS PE=1 SV=1 2107 2354 2.0E-16
sp|Q5HHW5|SAES_STAAC Histidine protein kinase SaeS OS=Staphylococcus aureus (strain COL) GN=saeS PE=1 SV=1 2107 2354 2.0E-16
sp|Q2G2U1|SAES_STAA8 Histidine protein kinase SaeS OS=Staphylococcus aureus (strain NCTC 8325) GN=saeS PE=1 SV=1 2107 2354 2.0E-16
sp|Q2FIT5|SAES_STAA3 Histidine protein kinase SaeS OS=Staphylococcus aureus (strain USA300) GN=saeS PE=3 SV=1 2107 2354 2.0E-16
sp|Q7A1J2|SAES_STAAW Histidine protein kinase SaeS OS=Staphylococcus aureus (strain MW2) GN=saeS PE=3 SV=1 2107 2354 3.0E-16
sp|Q6GBC5|SAES_STAAS Histidine protein kinase SaeS OS=Staphylococcus aureus (strain MSSA476) GN=saeS PE=3 SV=1 2107 2354 3.0E-16
sp|Q6GIT7|SAES_STAAR Histidine protein kinase SaeS OS=Staphylococcus aureus (strain MRSA252) GN=saeS PE=3 SV=1 2107 2354 3.0E-16
sp|Q7A6V4|SAES_STAAN Histidine protein kinase SaeS OS=Staphylococcus aureus (strain N315) GN=saeS PE=1 SV=1 2107 2354 3.0E-16
sp|Q99VR8|SAES_STAAM Histidine protein kinase SaeS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=saeS PE=3 SV=1 2107 2354 3.0E-16
sp|Q2YSM6|SAES_STAAB Histidine protein kinase SaeS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=saeS PE=3 SV=1 2107 2354 3.0E-16
sp|Q93CB7|MTRB_MYCPA Sensor histidine kinase MtrB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mtrB PE=3 SV=1 2111 2350 5.0E-16
sp|P30847|BAES_ECOLI Signal transduction histidine-protein kinase BaeS OS=Escherichia coli (strain K12) GN=baeS PE=1 SV=2 2117 2327 1.0E-15
sp|A0QTK3|MTRB_MYCS2 Sensor histidine kinase MtrB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mtrB PE=3 SV=2 2111 2322 2.0E-15
sp|P0AE82|CPXA_ECOLI Sensor protein CpxA OS=Escherichia coli (strain K12) GN=cpxA PE=1 SV=1 2105 2327 2.0E-15
sp|P0AE83|CPXA_ECOL6 Sensor protein CpxA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cpxA PE=3 SV=1 2105 2327 2.0E-15
sp|P0AE84|CPXA_ECO57 Sensor protein CpxA OS=Escherichia coli O157:H7 GN=cpxA PE=3 SV=1 2105 2327 2.0E-15
sp|Q869S5|DOKA_DICDI Hybrid signal transduction protein dokA OS=Dictyostelium discoideum GN=dokA PE=1 SV=1 2404 2529 3.0E-15
sp|P51392|YCF26_PORPU Uncharacterized sensor-like histidine kinase ycf26 OS=Porphyra purpurea GN=ycf26 PE=3 SV=1 2118 2354 3.0E-15
sp|P9WGK5|SENX3_MYCTU Sensor-like histidine kinase senX3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=senX3 PE=1 SV=1 2122 2352 4.0E-15
sp|P9WGK4|SENX3_MYCTO Sensor-like histidine kinase senX3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=senX3 PE=3 SV=1 2122 2352 4.0E-15
sp|P0A601|SENX3_MYCBO Sensor-like histidine kinase senX3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=senX3 PE=3 SV=1 2122 2352 4.0E-15
sp|O22267|CKI1_ARATH Histidine kinase CKI1 OS=Arabidopsis thaliana GN=CKI1 PE=1 SV=1 2116 2329 6.0E-15
sp|Q9C5U0|AHK4_ARATH Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 PE=1 SV=1 2271 2354 1.0E-14
sp|O34206|KINB_PSEAI Alginate biosynthesis sensor protein KinB OS=Pseudomonas aeruginosa GN=kinB PE=1 SV=1 2111 2350 1.0E-14
sp|Q5A872|SLN1_CANAL Histidine protein kinase SLN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLN1 PE=1 SV=1 2402 2529 1.0E-14
sp|P87323|MCS4_SCHPO Response regulator mcs4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcs4 PE=3 SV=1 2390 2526 1.0E-14
sp|O69729|TCRY_MYCTU Probable sensor histidine kinase TcrY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=tcrY PE=1 SV=1 2126 2327 1.0E-14
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase B OS=Dictyostelium discoideum GN=dhkB PE=1 SV=1 2403 2528 2.0E-14
sp|Q86AT9|DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum GN=dhkI-1 PE=3 SV=1 2403 2527 2.0E-14
sp|P71380|PHOR_HAEIN Phosphate regulon sensor protein PhoR OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=phoR PE=3 SV=1 2122 2350 3.0E-14
sp|A1A698|OHK4_ORYSJ Probable histidine kinase 4 OS=Oryza sativa subsp. japonica GN=HK4 PE=2 SV=1 2269 2428 4.0E-14
sp|Q8CTI3|SAES_STAES Histidine protein kinase SaeS OS=Staphylococcus epidermidis (strain ATCC 12228) GN=saeS PE=3 SV=2 2108 2350 4.0E-14
sp|Q5HR29|SAES_STAEQ Histidine protein kinase SaeS OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=saeS PE=3 SV=2 2108 2350 4.0E-14
sp|Q9ZHD4|SILS_SALTM Probable sensor kinase SilS OS=Salmonella typhimurium GN=silS PE=3 SV=1 2117 2339 6.0E-14
sp|P52101|GLRK_ECOLI Sensor histidine kinase GlrK OS=Escherichia coli (strain K12) GN=glrK PE=1 SV=3 2126 2356 6.0E-14
sp|P39928|SLN1_YEAST Osmosensing histidine protein kinase SLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLN1 PE=1 SV=1 2402 2526 7.0E-14
sp|P08400|PHOR_ECOLI Phosphate regulon sensor protein PhoR OS=Escherichia coli (strain K12) GN=phoR PE=1 SV=1 2111 2350 8.0E-14
sp|P58662|RCSC_SALTY Sensor histidine kinase RcsC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rcsC PE=3 SV=1 2382 2532 1.0E-13
sp|Q54Q69|DHKG_DICDI Hybrid signal transduction histidine kinase G OS=Dictyostelium discoideum GN=dhkG PE=3 SV=1 2400 2526 1.0E-13
sp|Q54W36|DHKH_DICDI Hybrid signal transduction histidine kinase H OS=Dictyostelium discoideum GN=dhkH PE=3 SV=1 2392 2536 1.0E-13
sp|E5KK10|FILI_METH6 Methanogenesis regulatory histidine kinase FilI OS=Methanosaeta harundinacea (strain 6Ac) GN=filI PE=1 SV=1 2096 2350 1.0E-13
sp|Q8XA47|QSEE_ECO57 Sensor histidine kinase QseE OS=Escherichia coli O157:H7 GN=qseE PE=1 SV=2 2126 2356 1.0E-13
sp|Q01549|PHY1_SELMA Phytochrome 1 OS=Selaginella martensii GN=PHY1 PE=3 SV=1 2104 2353 1.0E-13
sp|Q56128|RCSC_SALTI Sensor histidine kinase RcsC OS=Salmonella typhi GN=rcsC PE=3 SV=2 2382 2532 4.0E-13
sp|Q54W36|DHKH_DICDI Hybrid signal transduction histidine kinase H OS=Dictyostelium discoideum GN=dhkH PE=3 SV=1 2278 2350 4.0E-13
sp|Q08430|KINB_BACSU Sporulation kinase B OS=Bacillus subtilis (strain 168) GN=kinB PE=3 SV=4 2105 2345 4.0E-13
sp|P45609|PHOR_SHIDY Phosphate regulon sensor protein PhoR OS=Shigella dysenteriae GN=phoR PE=3 SV=1 2111 2350 4.0E-13
sp|O32193|CSSS_BACSU Sensor histidine kinase CssS OS=Bacillus subtilis (strain 168) GN=cssS PE=1 SV=2 2114 2341 5.0E-13
sp|Q39557|PHY2_CERPU Phytochrome 2 OS=Ceratodon purpureus GN=PHY2 PE=3 SV=1 2058 2353 5.0E-13
sp|O74539|MAK3_SCHPO Peroxide stress-activated histidine kinase mak3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak3 PE=1 SV=1 1895 2104 6.0E-13
sp|Q49ZT9|HSSS_STAS1 Heme sensor protein HssS OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=hssS PE=3 SV=1 2126 2360 6.0E-13
sp|P23621|PHOR_PSEAE Phosphate regulon sensor protein PhoR OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=phoR PE=3 SV=2 2111 2357 7.0E-13
sp|Q06904|SASA_SYNE7 Adaptive-response sensory-kinase SasA OS=Synechococcus elongatus (strain PCC 7942) GN=sasA PE=1 SV=2 2097 2350 8.0E-13
sp|Q08408|RPRX_BACFR Sensor protein RprX OS=Bacteroides fragilis (strain YCH46) GN=rprX PE=3 SV=2 2111 2358 9.0E-13
sp|B0JK50|SASA_MICAN Adaptive-response sensory-kinase SasA OS=Microcystis aeruginosa (strain NIES-843) GN=sasA PE=3 SV=1 2118 2350 1.0E-12
sp|P59342|BARA_SHIFL Signal transduction histidine-protein kinase BarA OS=Shigella flexneri GN=barA PE=3 SV=1 2389 2526 2.0E-12
sp|Q55E44|DHKE_DICDI Hybrid signal transduction histidine kinase E OS=Dictyostelium discoideum GN=dhkE PE=3 SV=1 2406 2523 2.0E-12
sp|Q8DMT2|SASA_THEEB Adaptive-response sensory-kinase SasA OS=Thermosynechococcus elongatus (strain BP-1) GN=sasA PE=3 SV=1 2114 2350 2.0E-12
sp|B7KFU0|SASA_CYAP7 Adaptive-response sensory-kinase SasA OS=Cyanothece sp. (strain PCC 7424) GN=sasA PE=3 SV=1 2110 2350 2.0E-12
sp|Q54Q69|DHKG_DICDI Hybrid signal transduction histidine kinase G OS=Dictyostelium discoideum GN=dhkG PE=3 SV=1 424 571 3.0E-12
sp|P93528|PHYC_SORBI Phytochrome C OS=Sorghum bicolor GN=PHYC PE=2 SV=1 2114 2369 3.0E-12
sp|O34638|YKOH_BACSU Sensor histidine kinase YkoH OS=Bacillus subtilis (strain 168) GN=ykoH PE=3 SV=1 2126 2333 3.0E-12
sp|P45608|PHOR_KLEPN Phosphate regulon sensor protein PhoR OS=Klebsiella pneumoniae GN=phoR PE=3 SV=1 2111 2364 4.0E-12
sp|Q8CSL7|ARLS_STAES Signal transduction histidine-protein kinase ArlS OS=Staphylococcus epidermidis (strain ATCC 12228) GN=arlS PE=3 SV=1 2117 2352 4.0E-12
sp|P94608|KDPD_CLOAB Sensor protein KdpD OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=kdpD PE=3 SV=2 2080 2353 4.0E-12
sp|A1A699|OHK6_ORYSJ Probable histidine kinase 6 OS=Oryza sativa subsp. japonica GN=HK6 PE=1 SV=1 2276 2368 5.0E-12
sp|P30733|PHYA_SOLTU Phytochrome A OS=Solanum tuberosum GN=PHYA PE=2 SV=2 2114 2357 5.0E-12
sp|Q55630|SASA_SYNY3 Adaptive-response sensory-kinase SasA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sasA PE=3 SV=1 2118 2350 5.0E-12
sp|Q5HPC4|ARLS_STAEQ Signal transduction histidine-protein kinase ArlS OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=arlS PE=3 SV=1 2117 2352 6.0E-12
sp|A6X580|DIVK_OCHA4 Polar-differentiation response regulator DivK OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=divK PE=3 SV=1 2404 2530 6.0E-12
sp|Q40762|PHY_PICAB Phytochrome OS=Picea abies PE=2 SV=1 2114 2358 6.0E-12
sp|A1TEL6|MPRB_MYCVP Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=mprB PE=3 SV=1 2118 2342 6.0E-12
sp|P0AEC5|BARA_ECOLI Signal transduction histidine-protein kinase BarA OS=Escherichia coli (strain K12) GN=barA PE=1 SV=1 2389 2526 7.0E-12
sp|P0AEC6|BARA_ECOL6 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=barA PE=1 SV=1 2389 2526 7.0E-12
sp|P0AEC7|BARA_ECO57 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O157:H7 GN=barA PE=3 SV=1 2389 2526 7.0E-12
sp|P0DMC5|RCSC_ECOLI Sensor histidine kinase RcsC OS=Escherichia coli (strain K12) GN=rcsC PE=1 SV=1 2382 2532 9.0E-12
sp|Q54SK5|DHKM_DICDI Hybrid signal transduction histidine kinase M OS=Dictyostelium discoideum GN=dhkM PE=3 SV=1 2404 2527 9.0E-12
sp|P0DMC6|RCSC_ECOLX Sensor histidine kinase RcsC OS=Escherichia coli GN=rcsC PE=1 SV=1 2382 2532 1.0E-11
sp|Q54RP6|DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum GN=dhkL PE=3 SV=1 2380 2526 1.0E-11
sp|Q9P7Q7|MAK1_SCHPO Peroxide stress-activated histidine kinase mak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak1 PE=3 SV=1 2396 2514 1.0E-11
sp|Q7XX84|ETR2_ORYSJ Ethylene receptor 2 OS=Oryza sativa subsp. japonica GN=ETR2 PE=1 SV=1 2119 2514 1.0E-11
sp|A0QR01|SENX3_MYCS2 Signal-transduction histidine kinase senX3 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=senX3 PE=1 SV=1 2126 2352 1.0E-11
sp|Q9R6X3|PHYB_NOSS1 Cyanobacterial phytochrome B OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=bphB PE=3 SV=1 2103 2350 1.0E-11
sp|Q3S4A7|AHK5_ARATH Histidine kinase 5 OS=Arabidopsis thaliana GN=AHK5 PE=1 SV=1 2403 2527 2.0E-11
sp|Q5A872|SLN1_CANAL Histidine protein kinase SLN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLN1 PE=1 SV=1 2096 2268 2.0E-11
sp|Q8FW53|DIVK_BRUSU Polar-differentiation response regulator DivK OS=Brucella suis biovar 1 (strain 1330) GN=divK PE=3 SV=1 2404 2530 2.0E-11
sp|A9WYT1|DIVK_BRUSI Polar-differentiation response regulator DivK OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=divK PE=3 SV=1 2404 2530 2.0E-11
sp|A5VUU3|DIVK_BRUO2 Polar-differentiation response regulator DivK OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=divK PE=3 SV=2 2404 2530 2.0E-11
sp|Q8YC73|DIVK_BRUME Polar-differentiation response regulator DivK OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=divK PE=3 SV=1 2404 2530 2.0E-11
sp|A9MBQ2|DIVK_BRUC2 Polar-differentiation response regulator DivK OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=divK PE=3 SV=1 2404 2530 2.0E-11
sp|Q7BBW0|DIVK_BRUAB Polar-differentiation response regulator DivK OS=Brucella abortus biovar 1 (strain 9-941) GN=divK PE=1 SV=1 2404 2530 2.0E-11
sp|Q2YKN1|DIVK_BRUA2 Polar-differentiation response regulator DivK OS=Brucella abortus (strain 2308) GN=divK PE=3 SV=1 2404 2530 2.0E-11
sp|B2SB45|DIVK_BRUA1 Polar-differentiation response regulator DivK OS=Brucella abortus (strain S19) GN=divK PE=3 SV=1 2404 2530 2.0E-11
sp|Q8H1X1|ETR2_ORYSI Ethylene receptor 2 OS=Oryza sativa subsp. indica GN=ETR2 PE=2 SV=3 2119 2514 2.0E-11
sp|A0QBR0|MPRB_MYCA1 Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium avium (strain 104) GN=mprB PE=3 SV=2 2118 2326 2.0E-11
sp|P08401|CREC_ECOLI Sensor protein CreC OS=Escherichia coli (strain K12) GN=creC PE=1 SV=2 2107 2346 2.0E-11
sp|Q9C5U1|AHK3_ARATH Histidine kinase 3 OS=Arabidopsis thaliana GN=AHK3 PE=1 SV=1 2403 2529 3.0E-11
sp|Q7A0W5|ARLS_STAAW Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MW2) GN=arlS PE=3 SV=1 2061 2345 3.0E-11
sp|Q6G9E7|ARLS_STAAS Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MSSA476) GN=arlS PE=3 SV=1 2061 2345 3.0E-11
sp|Q6GGZ4|ARLS_STAAR Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MRSA252) GN=arlS PE=3 SV=1 2061 2345 3.0E-11
sp|Q7A5N3|ARLS_STAAN Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain N315) GN=arlS PE=1 SV=1 2061 2345 3.0E-11
sp|Q7A2R7|ARLS_STAAM Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=arlS PE=3 SV=1 2061 2345 3.0E-11
sp|Q5HG05|ARLS_STAAC Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain COL) GN=arlS PE=3 SV=1 2061 2345 3.0E-11
sp|Q2YY04|ARLS_STAAB Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=arlS PE=3 SV=1 2061 2345 3.0E-11
sp|Q9KJN3|ARLS_STAA8 Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain NCTC 8325) GN=arlS PE=1 SV=1 2061 2345 3.0E-11
sp|Q2FH24|ARLS_STAA3 Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain USA300) GN=arlS PE=3 SV=1 2061 2345 3.0E-11
sp|P33529|PHY_MOUSC Phytochrome OS=Mougeotia scalaris GN=PHY PE=2 SV=2 2114 2353 3.0E-11
sp|P21865|KDPD_ECOLI Sensor protein KdpD OS=Escherichia coli (strain K12) GN=kdpD PE=1 SV=2 2084 2328 3.0E-11
sp|Q5SML4|OHK2_ORYSJ Probable histidine kinase 2 OS=Oryza sativa subsp. japonica GN=HK2 PE=2 SV=1 2113 2365 4.0E-11
sp|A2YA15|OHK2_ORYSI Probable histidine kinase 2 OS=Oryza sativa subsp. indica GN=HK2 PE=3 SV=1 2113 2365 4.0E-11
sp|P54883|SEX3_MYCLE Sensor-like histidine kinase senX3 OS=Mycobacterium leprae (strain TN) GN=senX3 PE=3 SV=1 2122 2366 4.0E-11
sp|Q7V6P7|SASA_PROMM Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain MIT 9313) GN=sasA PE=3 SV=1 2127 2350 4.0E-11
sp|P9WGL1|MPRB_MYCTU Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mprB PE=1 SV=1 2118 2326 4.0E-11
sp|P9WGL0|MPRB_MYCTO Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mprB PE=3 SV=1 2118 2326 4.0E-11
sp|A5U124|MPRB_MYCTA Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mprB PE=3 SV=1 2118 2326 4.0E-11
sp|P36505|PHY1_PHYPA Phytochrome 1 OS=Physcomitrella patens subsp. patens GN=PHY1 PE=2 SV=2 2105 2353 4.0E-11
sp|Q9Z5G7|MPRB_MYCLE Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium leprae (strain TN) GN=mprB PE=3 SV=1 2118 2326 5.0E-11
sp|Q742C0|MPRB_MYCPA Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mprB PE=3 SV=2 2118 2326 5.0E-11
sp|A0QNG1|PKNB_MYCS2 Serine/threonine-protein kinase PknB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pknB PE=1 SV=1 307 522 5.0E-11
sp|Q9C5U2|AHK2_ARATH Histidine kinase 2 OS=Arabidopsis thaliana GN=AHK2 PE=1 SV=1 2403 2536 6.0E-11
sp|Q86AT9|DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum GN=dhkI-1 PE=3 SV=1 2095 2256 6.0E-11
sp|Q49XM6|ARLS_STAS1 Signal transduction histidine-protein kinase ArlS OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=arlS PE=3 SV=1 2117 2352 6.0E-11
sp|Q8FK37|CUSS_ECOL6 Sensor kinase CusS OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cusS PE=3 SV=1 2113 2339 6.0E-11
sp|B1WYT4|SASA_CYAA5 Adaptive-response sensory-kinase SasA OS=Cyanothece sp. (strain ATCC 51142) GN=sasA PE=3 SV=1 2110 2350 7.0E-11
sp|Q9C5U0|AHK4_ARATH Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 PE=1 SV=1 2403 2541 8.0E-11
sp|P48027|GACS_PSESY Sensor protein GacS OS=Pseudomonas syringae pv. syringae GN=gacS PE=3 SV=1 2403 2514 1.0E-10
sp|Q54U87|DHKA_DICDI Hybrid signal transduction histidine kinase A OS=Dictyostelium discoideum GN=dhkA PE=1 SV=1 2403 2526 1.0E-10
sp|P39928|SLN1_YEAST Osmosensing histidine protein kinase SLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLN1 PE=1 SV=1 2278 2356 1.0E-10
sp|Q7BWI3|SASA_PROMA Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=sasA PE=3 SV=1 2061 2350 1.0E-10
sp|P33113|SPAK_BACIU Sensor histidine kinase SpaK OS=Bacillus subtilis GN=spaK PE=3 SV=3 2121 2328 2.0E-10
sp|A1KHB8|MPRB_MYCBP Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=mprB PE=3 SV=1 2118 2326 2.0E-10
sp|Q7U0X3|MPRB_MYCBO Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mprB PE=1 SV=1 2118 2326 2.0E-10
sp|P08982|ENVZ_SALTY Osmolarity sensor protein EnvZ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=envZ PE=3 SV=2 2077 2356 2.0E-10
sp|A8G5E7|SASA_PROM2 Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain MIT 9215) GN=sasA PE=3 SV=1 2121 2350 2.0E-10
sp|P42245|YCBM_BACSU Sensor histidine kinase YcbM OS=Bacillus subtilis (strain 168) GN=ycbM PE=3 SV=2 2126 2354 2.0E-10
sp|Q4L6C5|ARLS_STAHJ Signal transduction histidine-protein kinase ArlS OS=Staphylococcus haemolyticus (strain JCSC1435) GN=arlS PE=3 SV=1 2062 2353 2.0E-10
sp|P0DMK6|IRLS_BURPS Sensor protein IrlS OS=Burkholderia pseudomallei (strain K96243) GN=irlS PE=3 SV=1 2069 2348 2.0E-10
sp|P77485|CUSS_ECOLI Sensor kinase CusS OS=Escherichia coli (strain K12) GN=cusS PE=1 SV=1 2113 2339 2.0E-10
sp|Q7V113|SASA_PROMP Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=sasA PE=3 SV=1 2121 2350 2.0E-10
sp|I1WSZ3|IRLS_BURP2 Sensor protein IrlS OS=Burkholderia pseudomallei (strain 1026b) GN=irlS PE=3 SV=1 2069 2348 3.0E-10
sp|Q10MG9|PHYB_ORYSJ Phytochrome B OS=Oryza sativa subsp. japonica GN=PHYB PE=2 SV=1 2040 2341 3.0E-10
sp|A2C884|SASA_PROM3 Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain MIT 9303) GN=sasA PE=3 SV=1 2121 2350 3.0E-10
sp|P0AEJ5|ENVZ_SHIFL Osmolarity sensor protein EnvZ OS=Shigella flexneri GN=envZ PE=1 SV=1 2077 2362 3.0E-10
sp|P41406|ENVZ_SALTI Osmolarity sensor protein EnvZ OS=Salmonella typhi GN=envZ PE=3 SV=2 2077 2356 3.0E-10
sp|P0AEJ4|ENVZ_ECOLI Osmolarity sensor protein EnvZ OS=Escherichia coli (strain K12) GN=envZ PE=1 SV=1 2077 2362 3.0E-10
sp|P37461|ZRAS_SALTY Sensor protein ZraS OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=zraS PE=2 SV=2 2128 2350 3.0E-10
sp|A2BRQ6|SASA_PROMS Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain AS9601) GN=sasA PE=3 SV=1 2121 2350 4.0E-10
sp|Q3AYV8|SASA_SYNS9 Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain CC9902) GN=sasA PE=3 SV=1 2122 2357 5.0E-10
sp|Q7U871|SASA_SYNPX Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain WH8102) GN=sasA PE=3 SV=1 2122 2357 5.0E-10
sp|Q86AT9|DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum GN=dhkI-1 PE=3 SV=1 2248 2357 6.0E-10
sp|A0PWB3|MPRB_MYCUA Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium ulcerans (strain Agy99) GN=mprB PE=3 SV=1 2118 2326 6.0E-10
sp|A2XFW2|PHYB_ORYSI Phytochrome B OS=Oryza sativa subsp. indica GN=PHYB PE=3 SV=2 2040 2341 6.0E-10
sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 1897 2102 7.0E-10
sp|O31671|KIND_BACSU Sporulation kinase D OS=Bacillus subtilis (strain 168) GN=kinD PE=1 SV=1 2110 2350 7.0E-10
sp|P9WI81|PKNB_MYCTU Serine/threonine-protein kinase PknB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknB PE=1 SV=1 307 522 7.0E-10
sp|P9WI80|PKNB_MYCTO Serine/threonine-protein kinase PknB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknB PE=3 SV=1 307 522 7.0E-10
sp|P0A5S5|PKNB_MYCBO Serine/threonine-protein kinase PknB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknB PE=3 SV=1 307 522 7.0E-10
sp|P14714|PHYC_ARATH Phytochrome C OS=Arabidopsis thaliana GN=PHYC PE=1 SV=1 2114 2349 7.0E-10
sp|A3Q5L8|MPRB_MYCSJ Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium sp. (strain JLS) GN=mprB PE=3 SV=1 2118 2342 8.0E-10
sp|Q97IC2|PKN2_CLOAB Probable serine/threonine-protein kinase CA_C1728 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1728 PE=3 SV=1 344 528 8.0E-10
sp|Q06240|VANS_ENTFC Sensor protein VanS OS=Enterococcus faecium GN=vanS PE=3 SV=1 2110 2344 8.0E-10
sp|Q551X9|DHKF_DICDI Hybrid signal transduction histidine kinase F OS=Dictyostelium discoideum GN=dhkF PE=3 SV=1 2403 2515 9.0E-10
sp|P34094|PHYB_SOLTU Phytochrome B OS=Solanum tuberosum GN=PHYB PE=3 SV=2 2108 2335 9.0E-10
sp|P72292|CHVG_RHIME Sensor protein ChvG OS=Rhizobium meliloti (strain 1021) GN=chvG PE=3 SV=3 2126 2327 9.0E-10
sp|P42497|PHYD_ARATH Phytochrome D OS=Arabidopsis thaliana GN=PHYD PE=1 SV=2 2127 2332 9.0E-10
sp|Q1B3X9|MPRB_MYCSS Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium sp. (strain MCS) GN=mprB PE=3 SV=1 2118 2342 9.0E-10
sp|A1UL69|MPRB_MYCSK Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium sp. (strain KMS) GN=mprB PE=3 SV=1 2118 2342 9.0E-10
sp|Q8XBY4|CUSS_ECO57 Sensor kinase CusS OS=Escherichia coli O157:H7 GN=cusS PE=3 SV=1 2113 2338 9.0E-10
sp|Q7TYY6|PKNL_MYCBO Serine/threonine-protein kinase PknL OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknL PE=3 SV=1 365 525 1.0E-09
sp|P0A4I6|CIAH_STRR6 Sensor protein CiaH OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ciaH PE=3 SV=1 2118 2344 1.0E-09
sp|P0A4I5|CIAH_STRPN Sensor protein CiaH OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ciaH PE=3 SV=1 2118 2344 1.0E-09
sp|P9WI63|PKNL_MYCTU Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknL PE=1 SV=1 365 525 1.0E-09
sp|P9WI62|PKNL_MYCTO Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknL PE=3 SV=1 365 525 1.0E-09
sp|O31661|KINE_BACSU Sporulation kinase E OS=Bacillus subtilis (strain 168) GN=kinE PE=1 SV=1 2128 2350 1.0E-09
sp|A1A699|OHK6_ORYSJ Probable histidine kinase 6 OS=Oryza sativa subsp. japonica GN=HK6 PE=1 SV=1 2404 2527 2.0E-09
sp|Q41046|PHY_PINSY Phytochrome OS=Pinus sylvestris PE=2 SV=1 2127 2353 2.0E-09
sp|A6QGC0|PRKC_STAAE Serine/threonine-protein kinase PrkC OS=Staphylococcus aureus (strain Newman) GN=prkC PE=1 SV=1 365 520 2.0E-09
sp|Q2JKD9|SASA_SYNJB Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=sasA PE=3 SV=1 2123 2350 2.0E-09
sp|Q5A872|SLN1_CANAL Histidine protein kinase SLN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLN1 PE=1 SV=1 2282 2352 3.0E-09
sp|P14377|ZRAS_ECOLI Sensor protein ZraS OS=Escherichia coli (strain K12) GN=zraS PE=1 SV=2 2108 2354 3.0E-09
sp|P33530|PHYA1_TOBAC Phytochrome A1 OS=Nicotiana tabacum GN=PHYA1 PE=3 SV=1 2114 2357 4.0E-09
sp|P42498|PHYE_ARATH Phytochrome E OS=Arabidopsis thaliana GN=PHYE PE=1 SV=2 2127 2329 4.0E-09
sp|O34971|KDPD_RATRA Sensor protein KdpD OS=Rathayibacter rathayi GN=kdpD PE=3 SV=1 2036 2352 4.0E-09
sp|Q75KW7|ORR41_ORYSJ Two-component response regulator ORR41 OS=Oryza sativa subsp. japonica GN=RR41 PE=3 SV=1 2397 2519 4.0E-09
sp|Q95PI2|DHKC_DICDI Hybrid signal transduction histidine kinase C OS=Dictyostelium discoideum GN=dhkC PE=1 SV=1 2378 2553 5.0E-09
sp|Q9ZS62|PHYB1_SOLLC Phytochrome B1 OS=Solanum lycopersicum GN=PHYB1 PE=2 SV=1 2108 2335 5.0E-09
sp|P15939|NODV_BRADU Nodulation protein V OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodV PE=3 SV=1 2085 2354 5.0E-09
sp|P54744|PKNB_MYCLE Serine/threonine-protein kinase PknB OS=Mycobacterium leprae (strain TN) GN=pknB PE=3 SV=3 308 521 5.0E-09
sp|Q2JWK9|SASA_SYNJA Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain JA-3-3Ab) GN=sasA PE=3 SV=1 2123 2350 5.0E-09
sp|Q8YR50|SASA_NOSS1 Adaptive-response sensory-kinase SasA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=sasA PE=3 SV=1 2118 2352 5.0E-09
sp|B7K3M6|SASA_CYAP8 Adaptive-response sensory-kinase SasA OS=Cyanothece sp. (strain PCC 8801) GN=sasA PE=3 SV=1 2121 2350 7.0E-09
sp|Q3M8A7|SASA_ANAVT Adaptive-response sensory-kinase SasA OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=sasA PE=3 SV=1 2118 2352 7.0E-09
sp|Q9KM66|CQSS_VIBCH CAI-1 autoinducer sensor kinase/phosphatase CqsS OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cqsS PE=1 SV=1 2111 2358 7.0E-09
sp|P37599|CHEV_BACSU Chemotaxis protein CheV OS=Bacillus subtilis (strain 168) GN=cheV PE=1 SV=1 2398 2527 7.0E-09
sp|A1A697|OHK5_ORYSJ Probable histidine kinase 5 OS=Oryza sativa subsp. japonica GN=HK5 PE=2 SV=1 2314 2542 1.0E-08
sp|P9WGL3|KDPD_MYCTU Sensor protein KdpD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kdpD PE=1 SV=1 2076 2329 1.0E-08
sp|P9WGL2|KDPD_MYCTO Sensor protein KdpD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kdpD PE=3 SV=1 2076 2329 1.0E-08
sp|Q9S2C0|PKSC_STRCO Serine/threonine-protein kinase PksC OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pksC PE=3 SV=1 359 520 1.0E-08
sp|A1A696|OHK3_ORYSJ Probable histidine kinase 3 OS=Oryza sativa subsp. japonica GN=HK3 PE=2 SV=1 2403 2533 2.0E-08
sp|A2WYI4|OHK3_ORYSI Probable histidine kinase 3 OS=Oryza sativa subsp. indica GN=HK3 PE=2 SV=1 2403 2533 2.0E-08
sp|Q6GE72|HSSS_STAAR Heme sensor protein HssS OS=Staphylococcus aureus (strain MRSA252) GN=hssS PE=3 SV=1 2126 2352 2.0E-08
sp|Q7A3X0|HSSS_STAAN Heme sensor protein HssS OS=Staphylococcus aureus (strain N315) GN=hssS PE=3 SV=1 2126 2352 2.0E-08
sp|Q99RR5|HSSS_STAAM Heme sensor protein HssS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hssS PE=3 SV=1 2126 2352 2.0E-08
sp|A5IVE3|HSSS_STAA9 Heme sensor protein HssS OS=Staphylococcus aureus (strain JH9) GN=hssS PE=3 SV=1 2126 2352 2.0E-08
sp|A6U489|HSSS_STAA2 Heme sensor protein HssS OS=Staphylococcus aureus (strain JH1) GN=hssS PE=3 SV=1 2126 2352 2.0E-08
sp|A7X5Y6|HSSS_STAA1 Heme sensor protein HssS OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=hssS PE=3 SV=1 2126 2352 2.0E-08
sp|Q8NV46|HSSS_STAAW Heme sensor protein HssS OS=Staphylococcus aureus (strain MW2) GN=hssS PE=3 SV=1 2126 2352 2.0E-08
sp|Q6G6V8|HSSS_STAAS Heme sensor protein HssS OS=Staphylococcus aureus (strain MSSA476) GN=hssS PE=3 SV=1 2126 2352 2.0E-08
sp|Q8X614|ZRAS_ECO57 Sensor protein ZraS OS=Escherichia coli O157:H7 GN=zraS PE=3 SV=1 2108 2354 2.0E-08
sp|A8Z553|HSSS_STAAT Heme sensor protein HssS OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=hssS PE=3 SV=1 2126 2352 3.0E-08
sp|A6QJK4|HSSS_STAAE Heme sensor protein HssS OS=Staphylococcus aureus (strain Newman) GN=hssS PE=1 SV=1 2126 2352 3.0E-08
sp|Q5HDJ3|HSSS_STAAC Heme sensor protein HssS OS=Staphylococcus aureus (strain COL) GN=hssS PE=3 SV=1 2126 2352 3.0E-08
sp|Q2FVQ8|HSSS_STAA8 Heme sensor protein HssS OS=Staphylococcus aureus (strain NCTC 8325) GN=hssS PE=3 SV=1 2126 2352 3.0E-08
sp|Q2FED4|HSSS_STAA3 Heme sensor protein HssS OS=Staphylococcus aureus (strain USA300) GN=hssS PE=3 SV=1 2126 2352 3.0E-08
sp|Q6T5K2|ETR3_ORYSI Ethylene receptor 3 OS=Oryza sativa subsp. indica GN=ETR3 PE=2 SV=2 2093 2529 3.0E-08
sp|Q07737|CHVG_AGRFC Sensor protein ChvG OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=chvG PE=3 SV=2 2126 2327 3.0E-08
sp|P14712|PHYA_ARATH Phytochrome A OS=Arabidopsis thaliana GN=PHYA PE=1 SV=2 2114 2335 3.0E-08
sp|Q5SML4|OHK2_ORYSJ Probable histidine kinase 2 OS=Oryza sativa subsp. japonica GN=HK2 PE=2 SV=1 2402 2514 4.0E-08
sp|A2YA15|OHK2_ORYSI Probable histidine kinase 2 OS=Oryza sativa subsp. indica GN=HK2 PE=3 SV=1 2402 2514 4.0E-08
sp|Q8GP19|RSSA_SERMA Swarming motility regulation sensor protein RssA OS=Serratia marcescens GN=rssA PE=1 SV=2 2126 2325 4.0E-08
sp|A7N6S2|CQSS_VIBCB CAI-1 autoinducer sensor kinase/phosphatase CqsS OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cqsS PE=1 SV=1 2349 2527 4.0E-08
sp|Q52977|NTRB_RHIME Nitrogen regulation protein NtrB OS=Rhizobium meliloti (strain 1021) GN=ntrB PE=3 SV=2 2119 2326 4.0E-08
sp|P54738|PKN6_MYXXA Serine/threonine-protein kinase pkn6 OS=Myxococcus xanthus GN=pkn6 PE=2 SV=1 367 519 4.0E-08
sp|Q2YZ23|HSSS_STAAB Heme sensor protein HssS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=hssS PE=3 SV=1 2126 2352 4.0E-08
sp|Q0DWC7|ETR3_ORYSJ Ethylene receptor 3 OS=Oryza sativa subsp. japonica GN=ETR3 PE=2 SV=1 2093 2529 4.0E-08
sp|P45670|NTRB_AZOBR Nitrogen regulation protein NtrB OS=Azospirillum brasilense PE=3 SV=1 2084 2326 5.0E-08
sp|A1A698|OHK4_ORYSJ Probable histidine kinase 4 OS=Oryza sativa subsp. japonica GN=HK4 PE=2 SV=1 2404 2536 6.0E-08
sp|P36557|BASS_SALTY Sensor protein BasS OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=basS PE=1 SV=1 2125 2355 6.0E-08
sp|P0C5S6|LUXN_VIBHA Autoinducer 1 sensor kinase/phosphatase LuxN OS=Vibrio harveyi GN=luxN PE=3 SV=1 2127 2528 7.0E-08
sp|Q8XJL8|PKN2_CLOPE Probable serine/threonine-protein kinase CPE1738 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE1738 PE=3 SV=1 341 522 7.0E-08
sp|A7MRY4|LUXN_VIBCB Autoinducer 1 sensor kinase/phosphatase LuxN OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=luxN PE=1 SV=1 2127 2528 7.0E-08
sp|Q0IBF4|SASA_SYNS3 Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain CC9311) GN=sasA PE=3 SV=1 2121 2365 8.0E-08
sp|Q81WH6|PRKC_BACAN Serine/threonine-protein kinase PrkC OS=Bacillus anthracis GN=prkC PE=1 SV=1 424 517 8.0E-08
sp|O34989|YVRG_BACSU Sensor histidine kinase YvrG OS=Bacillus subtilis (strain 168) GN=yvrG PE=3 SV=2 2110 2354 8.0E-08
sp|Q9XA16|PKNX_STRCO Probable serine/threonine-protein kinase SCO3848 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3848 PE=3 SV=1 347 517 9.0E-08
sp|Q82EB2|CSEC_STRAW Sensor protein CseC OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=cseC PE=3 SV=1 2092 2322 1.0E-07
sp|Q9CEF5|PKNB_LACLA Probable serine/threonine-protein kinase PknB OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pknB PE=3 SV=1 363 553 1.0E-07
sp|P18392|RSTB_ECOLI Sensor protein RstB OS=Escherichia coli (strain K12) GN=rstB PE=1 SV=2 2122 2349 1.0E-07
sp|Q97PA9|STKP2_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 363 517 1.0E-07
sp|Q10CQ8|PHYC_ORYSJ Phytochrome C OS=Oryza sativa subsp. japonica GN=PHYC PE=2 SV=1 2114 2341 1.0E-07
sp|O22267|CKI1_ARATH Histidine kinase CKI1 OS=Arabidopsis thaliana GN=CKI1 PE=1 SV=1 2403 2520 2.0E-07
sp|A2XM23|PHYC_ORYSI Phytochrome C OS=Oryza sativa subsp. indica GN=PHYC PE=3 SV=2 2114 2341 2.0E-07
sp|Q8DNS0|STKP_STRR6 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=stkP PE=1 SV=1 363 517 2.0E-07
sp|Q04J43|STKP_STRP2 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=stkP PE=1 SV=1 363 517 2.0E-07
sp|P38889|SKN7_YEAST Transcription factor SKN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKN7 PE=1 SV=1 2383 2541 2.0E-07
sp|Q8KY50|STKP1_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 363 517 2.0E-07
sp|Q54SK5|DHKM_DICDI Hybrid signal transduction histidine kinase M OS=Dictyostelium discoideum GN=dhkM PE=3 SV=1 2277 2519 3.0E-07
sp|P16497|KINA_BACSU Sporulation kinase A OS=Bacillus subtilis (strain 168) GN=kinA PE=1 SV=2 2105 2354 3.0E-07
sp|P71403|CHEY_HELPY Chemotaxis protein CheY homolog OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=cheY PE=1 SV=2 2402 2529 3.0E-07
sp|P10955|FIXL_RHIME Sensor protein FixL OS=Rhizobium meliloti (strain 1021) GN=fixL PE=1 SV=2 2090 2350 3.0E-07
sp|P93527|PHYB_SORBI Phytochrome B OS=Sorghum bicolor GN=PHYB PE=3 SV=2 2040 2341 3.0E-07
sp|B2J946|SASA_NOSP7 Adaptive-response sensory-kinase SasA OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=sasA PE=3 SV=1 2117 2352 4.0E-07
sp|Q9ZM64|CHEY_HELPJ Chemotaxis protein CheY homolog OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=cheY PE=3 SV=1 2402 2529 5.0E-07
sp|Q02482|Y3689_SHEFN Putative sensor protein Sfri_3689 OS=Shewanella frigidimarina (strain NCIMB 400) GN=Sfri_3689 PE=3 SV=2 2231 2358 6.0E-07
sp|Q9HWR3|BPHY_PSEAE Bacteriophytochrome OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bphP PE=1 SV=1 2116 2344 6.0E-07
sp|P43501|PILH_PSEAE Protein PilH OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pilH PE=3 SV=1 2403 2528 6.0E-07
sp|P39486|DCTR_BACME Probable C4-dicarboxylate response regulator DctR OS=Bacillus megaterium GN=dctR PE=3 SV=1 2397 2528 7.0E-07
sp|P30844|BASS_ECOLI Sensor protein BasS OS=Escherichia coli (strain K12) GN=basS PE=1 SV=1 2125 2358 9.0E-07
sp|E0X9C7|TODS_PSEPT Sensor histidine kinase TodS OS=Pseudomonas putida (strain DOT-T1E) GN=todS PE=1 SV=1 2126 2352 1.0E-06
sp|A5W4E3|TODS_PSEP1 Sensor histidine kinase TodS OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todS PE=1 SV=1 2126 2352 1.0E-06
sp|P39928|SLN1_YEAST Osmosensing histidine protein kinase SLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLN1 PE=1 SV=1 2123 2274 1.0E-06
sp|P06593|PHYA3_AVESA Phytochrome A type 3 OS=Avena sativa GN=PHYA3 PE=1 SV=3 2132 2362 1.0E-06
sp|P06594|PHYA4_AVESA Phytochrome A type 4 OS=Avena sativa GN=PHYA4 PE=1 SV=3 2132 2362 1.0E-06
sp|Q0WPQ2|ETR2_ARATH Ethylene receptor 2 OS=Arabidopsis thaliana GN=ETR2 PE=1 SV=2 2041 2534 1.0E-06
sp|Q04943|AFSQ2_STRCO Signal transduction histidine-protein kinase AfsQ2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=afsQ2 PE=3 SV=1 2121 2322 1.0E-06
sp|Q8R9T6|PKN1_CALS4 Probable serine/threonine-protein kinase Sps1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=sps1 PE=3 SV=1 424 517 1.0E-06
sp|Q9HU20|DCTB_PSEAE C4-dicarboxylate transport sensor protein DctB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dctB PE=3 SV=1 2074 2329 1.0E-06
sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 2406 2527 2.0E-06
sp|Q9KM66|CQSS_VIBCH CAI-1 autoinducer sensor kinase/phosphatase CqsS OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cqsS PE=1 SV=1 2396 2527 2.0E-06
sp|Q8G6P9|PKNB_BIFLO Probable serine/threonine-protein kinase PknB OS=Bifidobacterium longum (strain NCC 2705) GN=pknB PE=3 SV=1 330 518 2.0E-06
sp|Q03069|DEGM_BACB2 Sensor protein DegM OS=Bacillus sp. (strain B21-2) GN=degM PE=3 SV=1 2115 2354 2.0E-06
sp|P14713|PHYB_ARATH Phytochrome B OS=Arabidopsis thaliana GN=PHYB PE=1 SV=1 2121 2341 2.0E-06
sp|P42707|NISK_LACLL Nisin biosynthesis sensor protein NisK OS=Lactococcus lactis subsp. lactis GN=nisK PE=3 SV=1 2070 2343 2.0E-06
sp|Q06067|ATOS_ECOLI Signal transduction histidine-protein kinase AtoS OS=Escherichia coli (strain K12) GN=atoS PE=3 SV=1 2105 2350 3.0E-06
sp|G7WMP8|FILR2_METH6 Probable methanogenesis regulatory protein FilR2 OS=Methanosaeta harundinacea (strain 6Ac) GN=filR2 PE=1 SV=1 2404 2524 3.0E-06
sp|P0AFB7|NTRB_SHIFL Nitrogen regulation protein NR(II) OS=Shigella flexneri GN=glnL PE=3 SV=1 2130 2338 3.0E-06
sp|P0AFB5|NTRB_ECOLI Nitrogen regulation protein NR(II) OS=Escherichia coli (strain K12) GN=glnL PE=1 SV=1 2130 2338 3.0E-06
sp|P0AFB6|NTRB_ECO57 Nitrogen regulation protein NR(II) OS=Escherichia coli O157:H7 GN=glnL PE=3 SV=1 2130 2338 3.0E-06
sp|Q9SPK4|PPCK1_ARATH Phosphoenolpyruvate carboxylase kinase 1 OS=Arabidopsis thaliana GN=PPCK1 PE=1 SV=1 357 519 3.0E-06
sp|O34507|PRKC_BACSU Serine/threonine-protein kinase PrkC OS=Bacillus subtilis (strain 168) GN=prkC PE=1 SV=1 365 517 3.0E-06
sp|P54737|PKN5_MYXXA Serine/threonine-protein kinase pkn5 OS=Myxococcus xanthus GN=pkn5 PE=2 SV=1 365 510 5.0E-06
sp|Q9ZEP3|CSEC_STRCO Sensor protein CseC OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cseC PE=1 SV=1 2092 2322 5.0E-06
sp|Q8THF6|MSMS_METAC Methyl sulfide methyltransferase-associated sensor OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=msmS PE=1 SV=1 2199 2344 6.0E-06
sp|Q9APE0|ZRAS_KLEOX Sensor protein ZraS OS=Klebsiella oxytoca GN=zraS PE=3 SV=1 2128 2349 6.0E-06
sp|P0A2D9|NTRB_SALTY Nitrogen regulation protein NR(II) OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=glnL PE=3 SV=1 2130 2338 7.0E-06
sp|P0A2E0|NTRB_SALTI Nitrogen regulation protein NR(II) OS=Salmonella typhi GN=glnL PE=3 SV=1 2130 2338 7.0E-06
sp|Q1DB00|MASK_MYXXD Tyrosine-protein kinase MasK OS=Myxococcus xanthus (strain DK 1622) GN=masK PE=1 SV=1 343 513 7.0E-06
sp|Q10DU0|PHYA_ORYSJ Phytochrome A OS=Oryza sativa subsp. japonica GN=PHYA PE=2 SV=1 1995 2357 9.0E-06
sp|A2XLG5|PHYA_ORYSI Phytochrome A OS=Oryza sativa subsp. indica GN=PHYA PE=3 SV=2 1995 2357 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000160 phosphorelay signal transduction system Yes
GO:0005515 protein binding Yes
GO:0000155 phosphorelay sensor kinase activity Yes
GO:0007165 signal transduction Yes
GO:0004673 protein histidine kinase activity No
GO:0035556 intracellular signal transduction No
GO:0050794 regulation of cellular process No
GO:0016775 phosphotransferase activity, nitrogenous group as acceptor No
GO:0065007 biological regulation No
GO:0004672 protein kinase activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0008150 biological_process No
GO:0140299 small molecule sensor activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0005488 binding No
GO:0009987 cellular process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0016301 kinase activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0050789 regulation of biological process No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3057
MYPTGKISRHGCPPPRGARATPVAEGPGQEAQLARKLAAAPCPVPRQSTHPPLSEFLQIDLPFPRRRLSAATDDG
RCAGPERNRRRTHVRAPENLRLDRTARLPLRRRRRRRPRGIMNDFGLAPDDVLDPPPPPPPPRLFDRLRQIAGYT
WDESQPPIHSTYDFWHVFGTRFVSSAATTPSLQQHDSVTRLQSGRPSPSDHGTHAPFDGQQSSFDSGRPPVPLPP
STPTAFLPSAEASFVEESIVARVSFHAVREERAFQLAKSVIANADPHGDHIVKPLDLIRLNPAAGDRSALIVAIY
AHPGHNFLRDVLDMGPAFYTARREGSDASLVSHRANTSASKPPINLEYFLDFAIGAAHCLEILHHGLGMVHGEIR
GDAFHFDAEGNKVRIESFGSGIRSFEHGLTSSGWSTLSREVGAKNKLLYISPEQTGRMPAEPDTRTDIYSLGVLL
WTLLTRQPVYSGDSPLDIVQGVLGRRIPNVATVRMDIPDVVGRIIQKCTAKNVADRYHSASGLRHDLVRVQQLLA
DGDSPALKDMMIGSRDVSSFFMLPTSMIGRQGEMNDLIKVIDRVAKLHAVHLKGPASRLVDGSCLGGETVLADDM
SSEGASSADGTNRRSGSFTHPTSSDAKLSRTGLHSSLLLSDSQTLSAETLSMHSGGLLFARPTRAWDRHLSMSTD
TASACDGLVDSTAGSSLSRQLGNAKFRRRGQCEIVIIEGAGGLGKSSLVQSVLPEARRRGYCATAKFDTARRTAF
GPLLKLLSSLFKQVWGERNTETAFHQGLKQYVRPVWPMLHRALGLPEFLLGPPETGPSRCVPCAPQAGGSRGGNG
QSSRAAAPPSPLSSPGALPTNASTSQQSPQDYLCSGTATKTTRLMNTCLDILRVFTAHKFITFCLDDVHFADDES
LELISQIIGARMKMVIIMTYRPEELPREKMERIIYPTEVSLVLGGKAADAEAEASRNSRPVVTRIKLSPLSEDDI
LGYVSTLLSRPKEETLPLALVIHSKTAGNPFYMREMLSACHRKRCIWYDYRDSQWHYDLERLLAQFQGERDYIVL
DTAFITQRLSELPSTARAVLAWAALLGNTFSFGLIARLMQGEFEYDDGCCPNPLKCSYTEGEAIAGLQAAIQAYI
VVPSETDDRFRFAHDRYVHASAALKECNARRMHYIISLVLLKYYADEARQRDSTASHICEAVSIIKSRVPQRREF
RRLLIECAQAAAENGARPTAAKYYSTAIQLLQDAPWTRQADDVSYEETMQLHLRAAECYLFMGQLSGANDLLTKI
FANARTPVDKAPAYVLQSRIFGQNGNALAAFVSLKECLAALGVPLKDEPTYERCDEWFGRLARQIRHMDRSELLR
PKRSGEAIIASIGAVLSETASAAWWSDCLHFYHLTLVMLEVHLARGAFPQSGMAFLNMGVVALSRFSMTQFAIEM
GAICQELLYQTGDAFSMARGHMIHACCIGHVQHAMPVTVAEMEDTIEMASVGGDRMSTILSYGLCAQAKFFASEN
CVDLEGFCQYGCEDIPNWCYDTRGGALLVAVRQLCRALQGKTRVDEADGVLSDEQHDGNAYKGWLTSQTQESNRS
SLFYESMELVVLFLYGHYERAVEVGRRGCQLLPLLWSARNSRLILFFYSLSRTGQLLRRMQDPCRAAGADFSAET
ASLVSELGRHVKMMEDWSTVSDVNYRCWTRLLAAQVAELREEHGQAIQLYEDALDHAAEHNFVFEEALGNYLLAG
FFIRRRARRSARAALRDAVGLYRQMAAGGVARVMEQEHSLLLHGPTRNYRTAEAGIQTDFVAAVPYRSGVDGDDH
DDDNDHDNDSRARRLPASNSLLVSQLGGDGWRGDSTSIQPRGGEGGGGCGSGSGGEGRGGGGGGGGGGKGGGGRG
GGGGGGGGGGGGGGGGGVGLPALDMIDLHAILVSSQVISSVLQVDELLKTMCDVVLQTCGGAATRAAIVVQDSDS
WCVAASGNPERGASAHKPGLSLSGTALVAENVVLYCTRFLEPVFIPDLLADERFGNVNEAWLQRNRLGKAIIAIP
ICHGTKPLLGVLYLEGEPGSFTDRNVTVLQLLVNQIGISYSNALSMNSVEKISAENRSMVSVQKRALAKALEAET
KAKNAEAEAKRNVKLAEEAAKAKSIFLANVSHELRTPLNGVIGNSELLRDSQLNRDQLEMADSIRVSADLLLTVI
NDILDFSKMEADKMKLYMIAFNPEEMVREVVRAVSYSNREKTSKKNVDIIQDIKLPPMLIYGDPIRLHQVLGNLI
GNSLKFTEHGSITIGARLDSDTDERATLTFWVRDTGIGIPPQQLAKLFQPFSQADASTARKYGGSGLGLSICKSL
IEMMMKGKIQLESEETVGTTAWFTVSFEKAKADVAAGDAQSKSSPPIDRYSATTSASERAASPNPFLDLTQMRKE
DVRICVAEDNPINQKIAIQYAQRLGYPSVSAYENGLKAVEGLRQKAREGKPYHIVLMDVQMPVLDGYEATKLLRR
DAMEAVRKVLVIAMTASAIQGDREKCLAAGMNDYLAKPVRSDVLRRKLDAYVSSARRFLPCSPPSPLNLPRTVCE
PETNGSSGGVSPTLGYDGQAVSMSMSMSMPVPVPVPLPLPLPLPLPVAVQDVAPTGQASSNGSRASSSDAASSRK
KQQQQQQQQPRRLIKGRVGEMEKMADKTSKGVSTTTTTTTTTMTDKATKGVLTKRSPQQHKTVTDLTLPPSSTKR
SPSS
Coding >Ophio5|3057
ATGTATCCGACCGGCAAAATCTCTCGGCACGGCTGTCCTCCGCCTCGCGGTGCACGCGCCACACCGGTTGCAGAA
GGTCCGGGCCAGGAGGCGCAGCTGGCGAGAAAGCTCGCCGCTGCCCCGTGCCCTGTGCCCCGGCAGTCTACTCAC
CCGCCTCTTTCCGAATTCTTGCAGATCGACTTGCCCTTTCCTCGTCGTCGTCTTTCGGCAGCGACCGATGATGGG
CGCTGCGCAGGGCCCGAGCGCAACCGTCGTCGAACACATGTCAGAGCCCCTGAGAATCTCCGCCTCGACCGCACC
GCGAGGCTGCCTCTCCGACGTCGACGACGACGACGACCGCGCGGCATCATGAATGACTTTGGCCTCGCGCCCGAC
GACGTGCTCGATCCGCCGCCGCCGCCGCCGCCGCCGCGCCTCTTCGACCGCCTCCGCCAGATTGCCGGTTACACG
TGGGACGAGTCTCAGCCGCCCATCCACTCGACGTACGATTTCTGGCATGTCTTCGGCACCCGCTTCGTCAGTTCG
GCGGCCACGACGCCCAGCCTCCAGCAACACGACTCGGTCACCAGGCTGCAGTCCGGCCGCCCTTCTCCGTCCGAT
CATGGCACTCATGCTCCTTTCGACGGCCAGCAGAGCTCCTTCGACTCCGGCCGCCCGCCCGTGCCGTTGCCGCCG
TCGACGCCGACAGCCTTCCTCCCGTCAGCCGAGGCCTCGTTCGTCGAGGAGTCCATCGTCGCCCGCGTGTCGTTT
CACGCCGTGCGCGAGGAGCGCGCCTTCCAGCTCGCCAAGAGCGTCATCGCCAATGCCGACCCTCATGGCGACCAC
ATCGTCAAGCCCCTCGACCTCATCCGCCTGAATCCCGCTGCCGGCGACCGCAGCGCTCTCATTGTGGCCATCTAC
GCACATCCCGGCCACAACTTCCTCCGTGACGTCCTCGACATGGGCCCGGCCTTTTACACGGCTCGAAGGGAAGGC
TCGGACGCGTCCTTGGTCTCCCACCGCGCCAACACGTCGGCCTCCAAGCCGCCCATCAACCTCGAGTATTTCCTC
GACTTCGCCATCGGAGCCGCCCACTGCCTCGAGATCCTCCACCACGGCCTTGGCATGGTTCACGGCGAAATTCGC
GGCGACGCTTTCCATTTCGACGCCGAGGGCAACAAGGTCAGGATCGAATCATTCGGCTCCGGTATCAGGTCCTTC
GAGCACGGCCTGACCAGCTCCGGCTGGTCGACATTGTCGCGTGAGGTGGGCGCCAAAAACAAGCTGCTCTACATC
AGCCCCGAGCAGACGGGCCGCATGCCGGCCGAGCCCGACACCCGCACCGACATATACTCGCTCGGCGTCCTGCTC
TGGACCTTGCTTACCCGCCAGCCCGTATACAGCGGCGACTCGCCGCTCGACATCGTCCAGGGCGTCCTCGGCCGG
CGCATCCCCAACGTGGCCACGGTCCGCATGGACATTCCCGACGTCGTCGGTCGCATCATCCAGAAGTGCACGGCC
AAGAACGTCGCCGATCGCTACCACTCGGCCAGCGGTCTTCGCCACGACCTGGTCCGCGTCCAGCAGCTCCTGGCC
GACGGCGACTCCCCGGCCCTCAAGGATATGATGATCGGGAGCCGCGACGTCTCGTCCTTTTTCATGCTGCCGACG
TCAATGATAGGCCGCCAGGGCGAGATGAATGACCTCATCAAGGTCATCGATCGCGTCGCCAAACTGCACGCCGTG
CACCTCAAAGGCCCCGCCAGCCGCCTCGTCGACGGCTCGTGCCTCGGCGGCGAGACGGTCCTGGCCGACGACATG
TCGAGCGAGGGCGCCAGCTCGGCTGACGGCACGAATCGGAGGAGTGGTTCCTTCACCCACCCGACGTCTTCCGAC
GCAAAACTCTCGAGGACCGGCCTCCACTCGTCGCTTCTCCTCTCCGACAGCCAGACACTATCAGCTGAAACCTTG
TCCATGCACTCCGGCGGCCTCCTCTTTGCGCGGCCGACGCGGGCCTGGGATCGCCACCTGTCCATGTCTACGGAT
ACGGCCAGCGCCTGCGACGGCCTGGTCGACTCGACCGCCGGCTCCAGCCTGTCGCGGCAACTGGGAAACGCCAAG
TTCCGCCGCCGCGGTCAGTGCGAGATTGTCATCATCGAGGGCGCCGGCGGCCTAGGCAAGAGCAGTCTCGTCCAG
AGCGTGCTTCCGGAGGCGCGCCGGCGCGGTTACTGCGCGACGGCCAAATTCGATACGGCGCGGCGAACGGCCTTC
GGACCACTGCTCAAGCTGCTGTCGTCCCTCTTCAAGCAGGTCTGGGGTGAGAGGAACACGGAGACAGCCTTCCAC
CAGGGCCTGAAGCAGTACGTCCGCCCCGTGTGGCCGATGCTGCACCGCGCGCTGGGGCTGCCCGAGTTCCTCCTC
GGGCCCCCGGAGACGGGGCCTTCGAGGTGCGTGCCCTGCGCGCCGCAGGCCGGGGGCTCACGGGGCGGCAACGGC
CAGAGCAGCCGGGCCGCGGCGCCGCCCTCTCCCCTGAGCTCGCCGGGGGCGCTGCCGACGAACGCGAGCACTTCG
CAGCAGAGCCCGCAAGACTACCTCTGCTCCGGCACGGCGACCAAGACGACGCGCCTCATGAACACTTGCCTCGAC
ATCCTGCGCGTCTTCACCGCTCACAAATTCATCACTTTTTGCCTTGACGACGTCCACTTCGCCGACGATGAGTCG
CTGGAACTCATCAGCCAGATTATCGGCGCCCGGATGAAGATGGTCATCATCATGACGTATCGGCCCGAGGAGCTC
CCCCGGGAGAAGATGGAGAGGATCATTTATCCGACCGAGGTCAGCCTCGTCCTCGGCGGCAAGGCGGCCGATGCC
GAGGCGGAAGCGTCGCGGAACAGCCGACCGGTGGTGACGAGAATCAAGCTCTCCCCGCTGAGCGAAGACGACATA
CTCGGCTACGTGTCGACGCTGCTGAGCCGGCCCAAGGAGGAGACGCTGCCGCTGGCGCTCGTCATCCACTCCAAG
ACGGCGGGCAACCCCTTTTATATGCGCGAGATGCTCAGCGCGTGCCACCGCAAGAGGTGCATCTGGTACGACTAC
CGCGACAGCCAGTGGCACTACGACCTGGAGAGGCTTCTGGCGCAGTTCCAGGGCGAAAGGGACTACATTGTCCTC
GACACGGCCTTCATCACGCAGCGCCTGAGCGAGCTGCCGTCGACGGCACGGGCGGTACTTGCTTGGGCCGCGCTT
CTGGGCAACACGTTTTCCTTTGGGCTTATCGCGCGTCTGATGCAGGGCGAGTTCGAGTACGACGACGGCTGCTGC
CCCAACCCCCTGAAGTGCTCTTACACCGAGGGCGAGGCCATCGCCGGGCTGCAGGCGGCCATCCAGGCCTACATC
GTCGTGCCGAGCGAGACGGACGATCGGTTCCGGTTCGCGCACGACCGCTACGTTCACGCGTCGGCGGCGCTCAAG
GAGTGCAACGCGCGGCGGATGCACTACATCATCTCGTTGGTGCTGCTCAAGTACTACGCCGACGAGGCCAGGCAG
CGGGACAGCACGGCGTCGCACATTTGCGAGGCCGTCTCCATCATCAAGAGCCGGGTTCCGCAGCGGCGCGAGTTC
CGGCGGCTGCTCATCGAGTGCGCACAGGCGGCGGCGGAGAACGGGGCGCGGCCGACGGCGGCCAAGTACTACAGC
ACGGCCATTCAGCTGCTCCAGGACGCGCCCTGGACCCGGCAGGCCGACGACGTGTCGTACGAGGAGACGATGCAG
CTGCACCTGCGTGCGGCCGAGTGCTACCTGTTCATGGGGCAGCTGTCCGGGGCAAACGACCTCCTGACGAAGATA
TTCGCCAACGCCCGGACGCCCGTCGACAAGGCGCCGGCCTACGTGCTGCAGTCGCGCATCTTCGGGCAGAACGGA
AACGCGCTGGCGGCCTTTGTATCTCTCAAGGAGTGCCTGGCGGCGCTCGGGGTGCCGCTCAAGGACGAGCCGACG
TACGAGCGGTGCGACGAGTGGTTCGGGAGGCTCGCGAGGCAGATACGGCACATGGACCGCTCGGAGCTGCTAAGA
CCCAAGCGGTCGGGCGAGGCCATCATCGCGTCCATCGGGGCGGTGCTTTCGGAGACGGCGAGCGCGGCTTGGTGG
AGCGACTGTCTGCACTTTTACCACCTGACGCTGGTCATGCTCGAGGTGCACCTGGCCAGGGGCGCCTTTCCGCAG
TCCGGCATGGCCTTTCTCAACATGGGCGTGGTGGCGCTGTCGAGGTTCAGCATGACGCAGTTTGCCATCGAGATG
GGGGCCATCTGTCAGGAGCTGCTCTATCAGACGGGCGACGCCTTCTCCATGGCGAGGGGCCACATGATTCACGCG
TGCTGCATTGGCCATGTCCAACACGCCATGCCGGTGACGGTGGCGGAGATGGAGGACACGATCGAGATGGCTTCG
GTGGGCGGCGACCGCATGTCGACGATACTCAGCTACGGCCTCTGCGCGCAAGCCAAGTTCTTCGCGAGCGAAAAC
TGCGTCGACCTCGAGGGCTTCTGCCAGTACGGCTGCGAGGACATACCTAACTGGTGCTACGATACTCGGGGCGGC
GCGTTGCTGGTGGCGGTGCGGCAGCTGTGCCGGGCGCTTCAGGGCAAGACTCGGGTCGACGAGGCGGATGGCGTG
CTGAGCGACGAGCAGCACGACGGGAATGCGTACAAGGGCTGGCTGACGAGCCAGACGCAGGAGAGCAACCGGTCG
TCGCTCTTCTACGAGAGCATGGAGCTCGTGGTCCTCTTCCTATACGGCCACTACGAGCGGGCCGTCGAGGTGGGC
CGCCGGGGCTGCCAGCTGCTGCCGCTGCTGTGGTCGGCGCGCAACAGCAGGCTGATACTGTTCTTCTACAGCCTG
TCTCGGACGGGTCAGCTGCTGCGGCGGATGCAGGACCCGTGCCGGGCGGCGGGGGCCGACTTCTCGGCCGAGACG
GCCTCATTGGTGTCGGAGCTGGGCCGACATGTCAAGATGATGGAAGACTGGTCGACGGTGTCGGACGTCAACTAT
CGATGCTGGACGCGACTGTTGGCGGCGCAGGTGGCGGAGCTGCGCGAGGAACACGGACAGGCGATCCAGCTTTAC
GAGGATGCGCTGGACCACGCGGCCGAGCACAACTTCGTCTTTGAGGAGGCGCTGGGCAACTACCTGCTGGCGGGC
TTCTTCATCCGGAGGAGGGCGCGGCGGTCGGCGAGGGCGGCTCTGAGGGACGCCGTCGGCCTGTACCGGCAGATG
GCGGCGGGCGGCGTGGCGAGAGTGATGGAACAGGAGCACAGCCTACTGCTTCACGGGCCGACGCGCAACTACCGG
ACGGCCGAGGCGGGGATACAGACGGACTTTGTGGCGGCCGTGCCGTATCGCAGCGGCGTCGACGGGGATGATCAT
GATGACGACAACGACCATGACAACGACAGCAGGGCGCGGCGCCTCCCGGCCAGCAACAGCCTTCTCGTTTCTCAG
CTCGGGGGCGACGGCTGGAGAGGCGACTCGACGAGCATCCAGCCCAGGGGCGGCGAAGGAGGAGGCGGATGCGGA
AGCGGAAGCGGAGGGGAAGGAAGAGGAGGAGGCGGCGGAGGAGGAGGAGGAGGAAAAGGAGGAGGGGGAAGGGGA
GGAGGAGGAGGAGGAGGAGGCGGGGGCGGAGGCGGAGGCGGAGGCGGAGGCGTCGGGCTACCGGCGCTCGATATG
ATCGACCTGCACGCCATCCTCGTGTCATCACAGGTCATCTCGTCGGTCCTCCAGGTCGACGAGCTGCTCAAGACC
ATGTGTGACGTGGTGCTCCAGACTTGCGGCGGCGCAGCCACTCGGGCTGCCATCGTGGTCCAGGACAGCGACTCG
TGGTGCGTCGCGGCCAGCGGCAACCCGGAAAGGGGCGCGTCCGCTCACAAGCCGGGCCTCTCGCTATCCGGAACG
GCGCTGGTGGCGGAGAACGTGGTGCTCTACTGCACCCGCTTCCTCGAGCCCGTCTTCATCCCTGACCTGCTGGCC
GACGAGCGGTTCGGAAACGTCAACGAGGCCTGGCTGCAGCGCAACCGGCTGGGCAAGGCCATCATCGCCATCCCC
ATCTGTCACGGTACCAAGCCGCTGCTCGGCGTCCTCTATCTCGAGGGCGAGCCCGGGTCGTTTACGGACCGCAAC
GTGACGGTGCTGCAGCTGCTCGTCAACCAGATCGGCATCAGCTACTCCAACGCCCTCTCCATGAACAGCGTGGAA
AAGATCTCGGCAGAGAACCGGTCCATGGTCTCGGTCCAGAAGCGGGCCCTGGCCAAGGCGCTCGAGGCCGAGACC
AAGGCCAAGAACGCCGAGGCCGAGGCCAAGCGCAACGTCAAACTGGCCGAGGAGGCGGCCAAGGCCAAGAGCATC
TTCCTGGCCAACGTCTCGCACGAGCTGCGGACGCCCCTCAACGGCGTCATCGGCAACTCGGAGCTGCTCAGGGAC
AGCCAGCTGAACCGGGACCAGCTCGAGATGGCCGACTCGATCCGCGTCTCGGCCGACCTGTTGCTGACCGTCATC
AACGACATCCTCGACTTTTCCAAGATGGAGGCGGACAAGATGAAGCTGTACATGATCGCCTTCAACCCGGAGGAG
ATGGTGCGCGAGGTCGTCAGGGCCGTCTCGTACAGCAACCGGGAGAAGACGTCCAAGAAGAATGTGGACATTATT
CAGGACATCAAGCTGCCGCCCATGCTCATCTACGGTGACCCGATCCGGCTGCACCAGGTGCTAGGCAACCTGATC
GGCAACAGCCTCAAGTTCACCGAGCACGGGTCCATCACCATCGGCGCCCGCCTCGACTCGGACACGGACGAGCGG
GCGACGCTGACGTTTTGGGTCCGCGACACGGGCATCGGCATCCCGCCCCAGCAGCTGGCCAAGCTGTTCCAGCCC
TTTAGCCAGGCCGACGCCAGCACGGCCCGCAAGTACGGCGGCAGCGGACTGGGGCTGAGCATCTGCAAGTCGCTC
ATCGAGATGATGATGAAGGGCAAGATCCAGCTCGAGAGCGAGGAGACGGTCGGCACCACGGCCTGGTTCACCGTG
TCGTTTGAAAAGGCAAAGGCCGACGTGGCCGCCGGGGACGCACAATCCAAGTCGTCGCCGCCCATCGACCGCTAT
TCGGCCACGACGTCGGCCTCGGAGCGGGCCGCGTCGCCGAACCCGTTCCTGGACTTGACGCAGATGAGAAAGGAG
GACGTACGGATCTGCGTGGCCGAGGACAACCCCATCAACCAGAAGATTGCCATCCAGTACGCTCAGCGGCTGGGC
TACCCGTCCGTCAGCGCTTACGAGAACGGGCTCAAGGCGGTCGAGGGACTACGGCAGAAGGCGCGCGAGGGCAAG
CCGTACCACATCGTCCTCATGGACGTGCAGATGCCGGTGCTCGACGGCTACGAGGCCACCAAGCTGCTGCGGAGG
GACGCCATGGAGGCGGTCCGCAAGGTGCTGGTCATCGCCATGACGGCCTCGGCCATTCAGGGGGATCGGGAGAAG
TGCCTGGCGGCCGGCATGAATGATTATCTGGCCAAACCGGTCCGGTCCGACGTGCTGCGTAGGAAGCTGGACGCC
TACGTTAGCAGCGCAAGGCGCTTCTTGCCTTGCTCGCCCCCGAGCCCCCTGAATCTTCCGCGGACCGTATGCGAG
CCCGAGACCAACGGGTCATCCGGCGGCGTCTCGCCGACGTTGGGGTACGACGGCCAAGCCGTGTCGATGTCGATG
TCGATGTCGATGCCGGTTCCGGTTCCGGTGCCGCTACCGTTGCCACTGCCACTGCCGCTGCCGGTGGCGGTACAG
GACGTGGCCCCGACGGGCCAGGCGTCTTCTAACGGGAGCCGCGCGTCGTCGTCGGATGCGGCCTCGTCGCGAAAG
AAGCAGCAACAGCAGCAGCAACAGCAGCCTCGGCGGCTGATCAAGGGTCGGGTCGGCGAGATGGAAAAGATGGCG
GACAAGACGTCCAAGGGGGTTTCGACGACGACGACGACGACGACGACGACGATGACGGACAAGGCGACCAAGGGG
GTCTTGACTAAGAGGAGTCCTCAGCAGCACAAGACGGTGACAGACCTGACGCTGCCGCCTAGCAGCACAAAGCGG
TCACCGTCGAGT
Transcript >Ophio5|3057
ATGTATCCGACCGGCAAAATCTCTCGGCACGGCTGTCCTCCGCCTCGCGGTGCACGCGCCACACCGGTTGCAGAA
GGTCCGGGCCAGGAGGCGCAGCTGGCGAGAAAGCTCGCCGCTGCCCCGTGCCCTGTGCCCCGGCAGTCTACTCAC
CCGCCTCTTTCCGAATTCTTGCAGATCGACTTGCCCTTTCCTCGTCGTCGTCTTTCGGCAGCGACCGATGATGGG
CGCTGCGCAGGGCCCGAGCGCAACCGTCGTCGAACACATGTCAGAGCCCCTGAGAATCTCCGCCTCGACCGCACC
GCGAGGCTGCCTCTCCGACGTCGACGACGACGACGACCGCGCGGCATCATGAATGACTTTGGCCTCGCGCCCGAC
GACGTGCTCGATCCGCCGCCGCCGCCGCCGCCGCCGCGCCTCTTCGACCGCCTCCGCCAGATTGCCGGTTACACG
TGGGACGAGTCTCAGCCGCCCATCCACTCGACGTACGATTTCTGGCATGTCTTCGGCACCCGCTTCGTCAGTTCG
GCGGCCACGACGCCCAGCCTCCAGCAACACGACTCGGTCACCAGGCTGCAGTCCGGCCGCCCTTCTCCGTCCGAT
CATGGCACTCATGCTCCTTTCGACGGCCAGCAGAGCTCCTTCGACTCCGGCCGCCCGCCCGTGCCGTTGCCGCCG
TCGACGCCGACAGCCTTCCTCCCGTCAGCCGAGGCCTCGTTCGTCGAGGAGTCCATCGTCGCCCGCGTGTCGTTT
CACGCCGTGCGCGAGGAGCGCGCCTTCCAGCTCGCCAAGAGCGTCATCGCCAATGCCGACCCTCATGGCGACCAC
ATCGTCAAGCCCCTCGACCTCATCCGCCTGAATCCCGCTGCCGGCGACCGCAGCGCTCTCATTGTGGCCATCTAC
GCACATCCCGGCCACAACTTCCTCCGTGACGTCCTCGACATGGGCCCGGCCTTTTACACGGCTCGAAGGGAAGGC
TCGGACGCGTCCTTGGTCTCCCACCGCGCCAACACGTCGGCCTCCAAGCCGCCCATCAACCTCGAGTATTTCCTC
GACTTCGCCATCGGAGCCGCCCACTGCCTCGAGATCCTCCACCACGGCCTTGGCATGGTTCACGGCGAAATTCGC
GGCGACGCTTTCCATTTCGACGCCGAGGGCAACAAGGTCAGGATCGAATCATTCGGCTCCGGTATCAGGTCCTTC
GAGCACGGCCTGACCAGCTCCGGCTGGTCGACATTGTCGCGTGAGGTGGGCGCCAAAAACAAGCTGCTCTACATC
AGCCCCGAGCAGACGGGCCGCATGCCGGCCGAGCCCGACACCCGCACCGACATATACTCGCTCGGCGTCCTGCTC
TGGACCTTGCTTACCCGCCAGCCCGTATACAGCGGCGACTCGCCGCTCGACATCGTCCAGGGCGTCCTCGGCCGG
CGCATCCCCAACGTGGCCACGGTCCGCATGGACATTCCCGACGTCGTCGGTCGCATCATCCAGAAGTGCACGGCC
AAGAACGTCGCCGATCGCTACCACTCGGCCAGCGGTCTTCGCCACGACCTGGTCCGCGTCCAGCAGCTCCTGGCC
GACGGCGACTCCCCGGCCCTCAAGGATATGATGATCGGGAGCCGCGACGTCTCGTCCTTTTTCATGCTGCCGACG
TCAATGATAGGCCGCCAGGGCGAGATGAATGACCTCATCAAGGTCATCGATCGCGTCGCCAAACTGCACGCCGTG
CACCTCAAAGGCCCCGCCAGCCGCCTCGTCGACGGCTCGTGCCTCGGCGGCGAGACGGTCCTGGCCGACGACATG
TCGAGCGAGGGCGCCAGCTCGGCTGACGGCACGAATCGGAGGAGTGGTTCCTTCACCCACCCGACGTCTTCCGAC
GCAAAACTCTCGAGGACCGGCCTCCACTCGTCGCTTCTCCTCTCCGACAGCCAGACACTATCAGCTGAAACCTTG
TCCATGCACTCCGGCGGCCTCCTCTTTGCGCGGCCGACGCGGGCCTGGGATCGCCACCTGTCCATGTCTACGGAT
ACGGCCAGCGCCTGCGACGGCCTGGTCGACTCGACCGCCGGCTCCAGCCTGTCGCGGCAACTGGGAAACGCCAAG
TTCCGCCGCCGCGGTCAGTGCGAGATTGTCATCATCGAGGGCGCCGGCGGCCTAGGCAAGAGCAGTCTCGTCCAG
AGCGTGCTTCCGGAGGCGCGCCGGCGCGGTTACTGCGCGACGGCCAAATTCGATACGGCGCGGCGAACGGCCTTC
GGACCACTGCTCAAGCTGCTGTCGTCCCTCTTCAAGCAGGTCTGGGGTGAGAGGAACACGGAGACAGCCTTCCAC
CAGGGCCTGAAGCAGTACGTCCGCCCCGTGTGGCCGATGCTGCACCGCGCGCTGGGGCTGCCCGAGTTCCTCCTC
GGGCCCCCGGAGACGGGGCCTTCGAGGTGCGTGCCCTGCGCGCCGCAGGCCGGGGGCTCACGGGGCGGCAACGGC
CAGAGCAGCCGGGCCGCGGCGCCGCCCTCTCCCCTGAGCTCGCCGGGGGCGCTGCCGACGAACGCGAGCACTTCG
CAGCAGAGCCCGCAAGACTACCTCTGCTCCGGCACGGCGACCAAGACGACGCGCCTCATGAACACTTGCCTCGAC
ATCCTGCGCGTCTTCACCGCTCACAAATTCATCACTTTTTGCCTTGACGACGTCCACTTCGCCGACGATGAGTCG
CTGGAACTCATCAGCCAGATTATCGGCGCCCGGATGAAGATGGTCATCATCATGACGTATCGGCCCGAGGAGCTC
CCCCGGGAGAAGATGGAGAGGATCATTTATCCGACCGAGGTCAGCCTCGTCCTCGGCGGCAAGGCGGCCGATGCC
GAGGCGGAAGCGTCGCGGAACAGCCGACCGGTGGTGACGAGAATCAAGCTCTCCCCGCTGAGCGAAGACGACATA
CTCGGCTACGTGTCGACGCTGCTGAGCCGGCCCAAGGAGGAGACGCTGCCGCTGGCGCTCGTCATCCACTCCAAG
ACGGCGGGCAACCCCTTTTATATGCGCGAGATGCTCAGCGCGTGCCACCGCAAGAGGTGCATCTGGTACGACTAC
CGCGACAGCCAGTGGCACTACGACCTGGAGAGGCTTCTGGCGCAGTTCCAGGGCGAAAGGGACTACATTGTCCTC
GACACGGCCTTCATCACGCAGCGCCTGAGCGAGCTGCCGTCGACGGCACGGGCGGTACTTGCTTGGGCCGCGCTT
CTGGGCAACACGTTTTCCTTTGGGCTTATCGCGCGTCTGATGCAGGGCGAGTTCGAGTACGACGACGGCTGCTGC
CCCAACCCCCTGAAGTGCTCTTACACCGAGGGCGAGGCCATCGCCGGGCTGCAGGCGGCCATCCAGGCCTACATC
GTCGTGCCGAGCGAGACGGACGATCGGTTCCGGTTCGCGCACGACCGCTACGTTCACGCGTCGGCGGCGCTCAAG
GAGTGCAACGCGCGGCGGATGCACTACATCATCTCGTTGGTGCTGCTCAAGTACTACGCCGACGAGGCCAGGCAG
CGGGACAGCACGGCGTCGCACATTTGCGAGGCCGTCTCCATCATCAAGAGCCGGGTTCCGCAGCGGCGCGAGTTC
CGGCGGCTGCTCATCGAGTGCGCACAGGCGGCGGCGGAGAACGGGGCGCGGCCGACGGCGGCCAAGTACTACAGC
ACGGCCATTCAGCTGCTCCAGGACGCGCCCTGGACCCGGCAGGCCGACGACGTGTCGTACGAGGAGACGATGCAG
CTGCACCTGCGTGCGGCCGAGTGCTACCTGTTCATGGGGCAGCTGTCCGGGGCAAACGACCTCCTGACGAAGATA
TTCGCCAACGCCCGGACGCCCGTCGACAAGGCGCCGGCCTACGTGCTGCAGTCGCGCATCTTCGGGCAGAACGGA
AACGCGCTGGCGGCCTTTGTATCTCTCAAGGAGTGCCTGGCGGCGCTCGGGGTGCCGCTCAAGGACGAGCCGACG
TACGAGCGGTGCGACGAGTGGTTCGGGAGGCTCGCGAGGCAGATACGGCACATGGACCGCTCGGAGCTGCTAAGA
CCCAAGCGGTCGGGCGAGGCCATCATCGCGTCCATCGGGGCGGTGCTTTCGGAGACGGCGAGCGCGGCTTGGTGG
AGCGACTGTCTGCACTTTTACCACCTGACGCTGGTCATGCTCGAGGTGCACCTGGCCAGGGGCGCCTTTCCGCAG
TCCGGCATGGCCTTTCTCAACATGGGCGTGGTGGCGCTGTCGAGGTTCAGCATGACGCAGTTTGCCATCGAGATG
GGGGCCATCTGTCAGGAGCTGCTCTATCAGACGGGCGACGCCTTCTCCATGGCGAGGGGCCACATGATTCACGCG
TGCTGCATTGGCCATGTCCAACACGCCATGCCGGTGACGGTGGCGGAGATGGAGGACACGATCGAGATGGCTTCG
GTGGGCGGCGACCGCATGTCGACGATACTCAGCTACGGCCTCTGCGCGCAAGCCAAGTTCTTCGCGAGCGAAAAC
TGCGTCGACCTCGAGGGCTTCTGCCAGTACGGCTGCGAGGACATACCTAACTGGTGCTACGATACTCGGGGCGGC
GCGTTGCTGGTGGCGGTGCGGCAGCTGTGCCGGGCGCTTCAGGGCAAGACTCGGGTCGACGAGGCGGATGGCGTG
CTGAGCGACGAGCAGCACGACGGGAATGCGTACAAGGGCTGGCTGACGAGCCAGACGCAGGAGAGCAACCGGTCG
TCGCTCTTCTACGAGAGCATGGAGCTCGTGGTCCTCTTCCTATACGGCCACTACGAGCGGGCCGTCGAGGTGGGC
CGCCGGGGCTGCCAGCTGCTGCCGCTGCTGTGGTCGGCGCGCAACAGCAGGCTGATACTGTTCTTCTACAGCCTG
TCTCGGACGGGTCAGCTGCTGCGGCGGATGCAGGACCCGTGCCGGGCGGCGGGGGCCGACTTCTCGGCCGAGACG
GCCTCATTGGTGTCGGAGCTGGGCCGACATGTCAAGATGATGGAAGACTGGTCGACGGTGTCGGACGTCAACTAT
CGATGCTGGACGCGACTGTTGGCGGCGCAGGTGGCGGAGCTGCGCGAGGAACACGGACAGGCGATCCAGCTTTAC
GAGGATGCGCTGGACCACGCGGCCGAGCACAACTTCGTCTTTGAGGAGGCGCTGGGCAACTACCTGCTGGCGGGC
TTCTTCATCCGGAGGAGGGCGCGGCGGTCGGCGAGGGCGGCTCTGAGGGACGCCGTCGGCCTGTACCGGCAGATG
GCGGCGGGCGGCGTGGCGAGAGTGATGGAACAGGAGCACAGCCTACTGCTTCACGGGCCGACGCGCAACTACCGG
ACGGCCGAGGCGGGGATACAGACGGACTTTGTGGCGGCCGTGCCGTATCGCAGCGGCGTCGACGGGGATGATCAT
GATGACGACAACGACCATGACAACGACAGCAGGGCGCGGCGCCTCCCGGCCAGCAACAGCCTTCTCGTTTCTCAG
CTCGGGGGCGACGGCTGGAGAGGCGACTCGACGAGCATCCAGCCCAGGGGCGGCGAAGGAGGAGGCGGATGCGGA
AGCGGAAGCGGAGGGGAAGGAAGAGGAGGAGGCGGCGGAGGAGGAGGAGGAGGAAAAGGAGGAGGGGGAAGGGGA
GGAGGAGGAGGAGGAGGAGGCGGGGGCGGAGGCGGAGGCGGAGGCGGAGGCGTCGGGCTACCGGCGCTCGATATG
ATCGACCTGCACGCCATCCTCGTGTCATCACAGGTCATCTCGTCGGTCCTCCAGGTCGACGAGCTGCTCAAGACC
ATGTGTGACGTGGTGCTCCAGACTTGCGGCGGCGCAGCCACTCGGGCTGCCATCGTGGTCCAGGACAGCGACTCG
TGGTGCGTCGCGGCCAGCGGCAACCCGGAAAGGGGCGCGTCCGCTCACAAGCCGGGCCTCTCGCTATCCGGAACG
GCGCTGGTGGCGGAGAACGTGGTGCTCTACTGCACCCGCTTCCTCGAGCCCGTCTTCATCCCTGACCTGCTGGCC
GACGAGCGGTTCGGAAACGTCAACGAGGCCTGGCTGCAGCGCAACCGGCTGGGCAAGGCCATCATCGCCATCCCC
ATCTGTCACGGTACCAAGCCGCTGCTCGGCGTCCTCTATCTCGAGGGCGAGCCCGGGTCGTTTACGGACCGCAAC
GTGACGGTGCTGCAGCTGCTCGTCAACCAGATCGGCATCAGCTACTCCAACGCCCTCTCCATGAACAGCGTGGAA
AAGATCTCGGCAGAGAACCGGTCCATGGTCTCGGTCCAGAAGCGGGCCCTGGCCAAGGCGCTCGAGGCCGAGACC
AAGGCCAAGAACGCCGAGGCCGAGGCCAAGCGCAACGTCAAACTGGCCGAGGAGGCGGCCAAGGCCAAGAGCATC
TTCCTGGCCAACGTCTCGCACGAGCTGCGGACGCCCCTCAACGGCGTCATCGGCAACTCGGAGCTGCTCAGGGAC
AGCCAGCTGAACCGGGACCAGCTCGAGATGGCCGACTCGATCCGCGTCTCGGCCGACCTGTTGCTGACCGTCATC
AACGACATCCTCGACTTTTCCAAGATGGAGGCGGACAAGATGAAGCTGTACATGATCGCCTTCAACCCGGAGGAG
ATGGTGCGCGAGGTCGTCAGGGCCGTCTCGTACAGCAACCGGGAGAAGACGTCCAAGAAGAATGTGGACATTATT
CAGGACATCAAGCTGCCGCCCATGCTCATCTACGGTGACCCGATCCGGCTGCACCAGGTGCTAGGCAACCTGATC
GGCAACAGCCTCAAGTTCACCGAGCACGGGTCCATCACCATCGGCGCCCGCCTCGACTCGGACACGGACGAGCGG
GCGACGCTGACGTTTTGGGTCCGCGACACGGGCATCGGCATCCCGCCCCAGCAGCTGGCCAAGCTGTTCCAGCCC
TTTAGCCAGGCCGACGCCAGCACGGCCCGCAAGTACGGCGGCAGCGGACTGGGGCTGAGCATCTGCAAGTCGCTC
ATCGAGATGATGATGAAGGGCAAGATCCAGCTCGAGAGCGAGGAGACGGTCGGCACCACGGCCTGGTTCACCGTG
TCGTTTGAAAAGGCAAAGGCCGACGTGGCCGCCGGGGACGCACAATCCAAGTCGTCGCCGCCCATCGACCGCTAT
TCGGCCACGACGTCGGCCTCGGAGCGGGCCGCGTCGCCGAACCCGTTCCTGGACTTGACGCAGATGAGAAAGGAG
GACGTACGGATCTGCGTGGCCGAGGACAACCCCATCAACCAGAAGATTGCCATCCAGTACGCTCAGCGGCTGGGC
TACCCGTCCGTCAGCGCTTACGAGAACGGGCTCAAGGCGGTCGAGGGACTACGGCAGAAGGCGCGCGAGGGCAAG
CCGTACCACATCGTCCTCATGGACGTGCAGATGCCGGTGCTCGACGGCTACGAGGCCACCAAGCTGCTGCGGAGG
GACGCCATGGAGGCGGTCCGCAAGGTGCTGGTCATCGCCATGACGGCCTCGGCCATTCAGGGGGATCGGGAGAAG
TGCCTGGCGGCCGGCATGAATGATTATCTGGCCAAACCGGTCCGGTCCGACGTGCTGCGTAGGAAGCTGGACGCC
TACGTTAGCAGCGCAAGGCGCTTCTTGCCTTGCTCGCCCCCGAGCCCCCTGAATCTTCCGCGGACCGTATGCGAG
CCCGAGACCAACGGGTCATCCGGCGGCGTCTCGCCGACGTTGGGGTACGACGGCCAAGCCGTGTCGATGTCGATG
TCGATGTCGATGCCGGTTCCGGTTCCGGTGCCGCTACCGTTGCCACTGCCACTGCCGCTGCCGGTGGCGGTACAG
GACGTGGCCCCGACGGGCCAGGCGTCTTCTAACGGGAGCCGCGCGTCGTCGTCGGATGCGGCCTCGTCGCGAAAG
AAGCAGCAACAGCAGCAGCAACAGCAGCCTCGGCGGCTGATCAAGGGTCGGGTCGGCGAGATGGAAAAGATGGCG
GACAAGACGTCCAAGGGGGTTTCGACGACGACGACGACGACGACGACGACGATGACGGACAAGGCGACCAAGGGG
GTCTTGACTAAGAGGAGTCCTCAGCAGCACAAGACGGTGACAGACCTGACGCTGCCGCCTAGCAGCACAAAGCGG
TCACCGTCGAGTTGA
Gene >Ophio5|3057
ATGTATCCGACCGGCAAAATGTTCGCGGGAAGCTACTAGCACGCAGCTAGTGTACCTGCAGCTCTCGGCACGGCT
GTCCTCCGCCTCGCGGTGCACGCGCCACACCGGTTGCAGAAGGTCCGGGCCAGGAGGCGCAGTAACGTGTTCGCC
CCCATTGATCCCTTTTCGTTTCGAATCGGACTGCAACACAACGCAGGCTGGCGAGAAAGCTCGCCGCTGCCCCGT
GCCCTGTGCCCCGGCAGTCTACTCACCCGCCTCTTTCCGAATTCTTGCAGATCGACTTGCCCTTTCCTCGTCGTC
GTCTTTCGGCAGCGACCGATGATGGGCGCTGCGCAGGGCCCGAGCGCAACCGTCGTCGAACACATGTCAGAGCCC
CTGAGAATCTCCGCCTCGACCGCACCGCGAGGCTGCCTCTCCGACGTCGACGACGACGACGACCGCGCGGCATCA
TGAATGACTTTGGCCTCGCGCCCGACGACGTGCTCGATCCGCCGCCGCCGCCGCCGCCGCCGCGCCTCTTCGACC
GCCTCCGCCAGATTGCCGGTTACACGTGGGACGAGTCTCAGCCGCCCATCCACTCGACGTACGATTTCTGGTCAG
TGTTTTTTTTTCCCGTTCTCCTCGCCTAACTGCCTATTTCTTGTGATCTTTTCTATCCAGCAAGAAGCTAATATC
TGCCCCCACCTATCCTGTCCTTAGGCATGTCTTCGGCACCCGCTTCGTCAGTTCGGCGGCCACGACGCCCAGCCT
CCAGCAACACGACTCGGTCACCAGGCTGCAGTCCGGCCGCCCTTCTCCGTCCGATCATGGCACTCATGCTCCTTT
CGACGGCCAGCAGAGCTCCTTCGACTCCGGCCGCCCGCCCGTGCCGTTGCCGCCGTCGACGCCGACAGCCTTCCT
CCCGTCAGCCGAGGCCTCGTTCGTCGAGGAGTCCATCGTCGCCCGCGTGTCGTTTCACGCCGTGCGCGAGGAGCG
CGCCTTCCAGCTCGCCAAGAGCGTCATCGCCAATGCCGACCCTCATGGCGACCACATCGTCAAGCCCCTCGACCT
CATCCGCCTGAATCCCGCTGCCGGCGACCGCAGCGCTCTCATTGTGGCCATCTACGCACATCCCGGCCACAACTT
CCTCCGTGACGTCCTCGACATGGGCCCGGCCTTTTACACGGCTCGAAGGGAAGGCTCGGACGCGTCCTTGGTCTC
CCACCGCGCCAACACGTCGGCCTCCAAGCCGCCCATCAACCTCGAGTATTTCCTCGACTTCGCCATCGGAGCCGC
CCACTGCCTCGAGATCCTCCACCACGGCCTTGGCATGGTTCACGGCGAAATTCGCGGCGACGCTTTCCATTTCGA
CGCCGAGGGCAACAAGGTCAGGATCGAATCATTCGGCTCCGGTATCAGGTCCTTCGAGCACGGCCTGACCAGCTC
CGGCTGGTCGACATTGTCGCGTGAGGTGGGCGCCAAAAACAAGCTGCTCTACATCAGCCCCGAGCAGACGGGCCG
CATGCCGGCCGAGCCCGACACCCGCACCGACATATACTCGCTCGGCGTCCTGCTCTGGACCTTGCTTACCCGCCA
GCCCGTATACAGCGGCGACTCGCCGCTCGACATCGTCCAGGGCGTCCTCGGCCGGCGCATCCCCAACGTGGCCAC
GGTCCGCATGGACATTCCCGACGTCGTCGGTCGCATCATCCAGAAGTGCACGGCCAAGAACGTCGCCGATCGCTA
CCACTCGGCCAGCGGTCTTCGCCACGACCTGGTCCGCGTCCAGCAGCTCCTGGCCGACGGCGACTCCCCGGCCCT
CAAGGATATGATGATCGGGAGCCGCGACGTCTCGTCCTTTTTCATGCTGCCGACGTCAATGATAGGCCGCCAGGG
CGAGATGAATGACCTCATCAAGGTCATCGATCGCGTCGCCAAACTGCACGCCGTGCACCTCAAAGGCCCCGCCAG
CCGCCTCGTCGACGGCTCGTGCCTCGGCGGCGAGACGGTCCTGGCCGACGACATGTCGAGCGAGGGCGCCAGCTC
GGCTGACGGCACGAATCGGAGGAGTGGTTCCTTCACCCACCCGACGTCTTCCGACGCAAAACTCTCGAGGACCGG
CCTCCACTCGTCGCTTCTCCTCTCCGACAGCCAGACACTATCAGCTGAAACCTTGTCCATGCACTCCGGCGGCCT
CCTCTTTGCGCGGCCGACGCGGGCCTGGGATCGCCACCTGTCCATGTCTACGGATACGGCCAGCGCCTGCGACGG
CCTGGTCGACTCGACCGCCGGCTCCAGCCTGTCGCGGCAACTGGGAAACGCCAAGTTCCGCCGCCGCGGTCAGTG
CGAGATTGTCATCATCGAGGGCGCCGGCGGCCTAGGCAAGAGCAGTCTCGTCCAGAGCGTGCTTCCGGAGGCGCG
CCGGCGCGGTTACTGCGCGACGGCCAAATTCGATACGGCGCGGCGAACGGCCTTCGGACCACTGCTCAAGCTGCT
GTCGTCCCTCTTCAAGCAGGTCTGGGGTGAGAGGAACACGGAGACAGCCTTCCACCAGGGCCTGAAGCAGTACGT
CCGCCCCGTGTGGCCGATGCTGCACCGCGCGCTGGGGCTGCCCGAGTTCCTCCTCGGGCCCCCGGAGACGGGGCC
TTCGAGGTGCGTGCCCTGCGCGCCGCAGGCCGGGGGCTCACGGGGCGGCAACGGCCAGAGCAGCCGGGCCGCGGC
GCCGCCCTCTCCCCTGAGCTCGCCGGGGGCGCTGCCGACGAACGCGAGCACTTCGCAGCAGAGCCCGCAAGACTA
CCTCTGCTCCGGCACGGCGACCAAGACGACGCGCCTCATGAACACTTGCCTCGACATCCTGCGCGTCTTCACCGC
TCACAAATTCATCACTTTTTGCCTTGACGACGTCCACTTCGCCGACGATGAGTCGCTGGAACTCATCAGCCAGAT
TATCGGCGCCCGGATGAAGATGGTCATCATCATGACGTATCGGCCCGAGGAGCTCCCCCGGGAGAAGATGGAGAG
GATCATTTATCCGACCGAGGTCAGCCTCGTCCTCGGCGGCAAGGCGGCCGATGCCGAGGCGGAAGCGTCGCGGAA
CAGCCGACCGGTGGTGACGAGAATCAAGCTCTCCCCGCTGAGCGAAGACGACATACTCGGCTACGTGTCGACGCT
GCTGAGCCGGCCCAAGGAGGAGACGCTGCCGCTGGCGCTCGTCATCCACTCCAAGACGGCGGGCAACCCCTTTTA
TATGCGCGAGATGCTCAGCGCGTGCCACCGCAAGAGGTGCATCTGGTACGACTACCGCGACAGCCAGTGGCACTA
CGACCTGGAGAGGCTTCTGGCGCAGTTCCAGGGCGAAAGGGACTACATTGTCCTCGACACGGCCTTCATCACGCA
GCGCCTGAGCGAGCTGCCGTCGACGGCACGGGCGGTACTTGCTTGGGCCGCGCTTCTGGGCAACACGTTTTCCTT
TGGGCTTATCGCGCGTCTGATGCAGGGCGAGTTCGAGTACGACGACGGCTGCTGCCCCAACCCCCTGAAGTGCTC
TTACACCGAGGGCGAGGCCATCGCCGGGCTGCAGGCGGCCATCCAGGCCTACATCGTCGTGCCGAGCGAGACGGA
CGATCGGTTCCGGTTCGCGCACGACCGCTACGTTCACGCGTCGGCGGCGCTCAAGGAGTGCAACGCGCGGCGGAT
GCACTACATCATCTCGTTGGTGCTGCTCAAGTACTACGCCGACGAGGCCAGGCAGCGGGACAGCACGGCGTCGCA
CATTTGCGAGGCCGTCTCCATCATCAAGAGCCGGGTTCCGCAGCGGCGCGAGTTCCGGCGGCTGCTCATCGAGTG
CGCACAGGCGGCGGCGGAGAACGGGGCGCGGCCGACGGCGGCCAAGTACTACAGCACGGCCATTCAGCTGCTCCA
GGACGCGCCCTGGACCCGGCAGGCCGACGACGTGTCGTACGAGGAGACGATGCAGCTGCACCTGCGTGCGGCCGA
GTGCTACCTGTTCATGGGGCAGCTGTCCGGGGCAAACGACCTCCTGACGAAGATATTCGCCAACGCCCGGACGCC
CGTCGACAAGGCGCCGGCCTACGTGCTGCAGTCGCGCATCTTCGGGCAGAACGGAAACGCGCTGGCGGCCTTTGT
ATCTCTCAAGGAGTGCCTGGCGGCGCTCGGGGTGCCGCTCAAGGACGAGCCGACGTACGAGCGGTGCGACGAGTG
GTTCGGGAGGCTCGCGAGGCAGATACGGCACATGGACCGCTCGGAGCTGCTAAGACCCAAGCGGTCGGGCGAGGC
CATCATCGCGTCCATCGGGGCGGTGCTTTCGGAGACGGCGAGCGCGGCTTGGTGGAGCGACTGTCTGCACTTTTA
CCACCTGACGCTGGTCATGCTCGAGGTGCACCTGGCCAGGGGCGCCTTTCCGCAGTCCGGCATGGCCTTTCTCAA
CATGGGCGTGGTGGCGCTGTCGAGGTTCAGCATGACGCAGTTTGCCATCGAGATGGGGGCCATCTGTCAGGAGCT
GCTCTATCAGACGGGCGACGCCTTCTCCATGGCGAGGGGCCACATGATTCACGCGTGCTGCATTGGCCATGTCCA
ACACGCCATGCCGGTGACGGTGGCGGAGATGGAGGACACGATCGAGATGGCTTCGGTGGGCGGCGACCGCATGTC
GACGATACTCAGCTACGGCCTCTGCGCGCAAGCCAAGTTCTTCGCGAGCGAAAACTGCGTCGACCTCGAGGGCTT
CTGCCAGTACGGCTGCGAGGACATACCTAACTGGTGCTACGATACTCGGGGCGGCGCGTTGCTGGTGGCGGTGCG
GCAGCTGTGCCGGGCGCTTCAGGGCAAGACTCGGGTCGACGAGGCGGATGGCGTGCTGAGCGACGAGCAGCACGA
CGGGAATGCGTACAAGGGCTGGCTGACGAGCCAGACGCAGGAGAGCAACCGGTCGTCGCTCTTCTACGAGAGCAT
GGAGCTCGTGGTCCTCTTCCTATACGGCCACTACGAGCGGGCCGTCGAGGTGGGCCGCCGGGGCTGCCAGCTGCT
GCCGCTGCTGTGGTCGGCGCGCAACAGCAGGCTGATACTGTTCTTCTACAGCCTGTCTCGGACGGGTCAGCTGCT
GCGGCGGATGCAGGACCCGTGCCGGGCGGCGGGGGCCGACTTCTCGGCCGAGACGGCCTCATTGGTGTCGGAGCT
GGGCCGACATGTCAAGATGATGGAAGACTGGTCGACGGTGTCGGACGTCAACTATCGATGCTGGACGCGACTGTT
GGCGGCGCAGGTGGCGGAGCTGCGCGAGGAACACGGACAGGCGATCCAGCTTTACGAGGATGCGCTGGACCACGC
GGCCGAGCACAACTTCGTCTTTGAGGAGGCGCTGGGCAACTACCTGCTGGCGGGCTTCTTCATCCGGAGGAGGGC
GCGGCGGTCGGCGAGGGCGGCTCTGAGGGACGCCGTCGGCCTGTACCGGCAGATGGCGGCGGGCGGCGTGGCGAG
AGTGATGGAACAGGAGCACAGCCTACTGCTTCACGGGCCGACGCGCAACTACCGGACGGCCGAGGCGGGGATACA
GACGGACTTTGTGGCGGCCGTGCCGTATCGCAGCGGCGTCGACGGGGATGATCATGATGACGACAACGACCATGA
CAACGACAGCAGGGCGCGGCGCCTCCCGGCCAGCAACAGCCTTCTCGTTTCTCAGCTCGGGGGCGACGGCTGGAG
AGGCGACTCGACGAGCATCCAGCCCAGGGGCGGCGAAGGAGGAGGCGGATGCGGAAGCGGAAGCGGAGGGGAAGG
AAGAGGAGGAGGCGGCGGAGGAGGAGGAGGAGGAAAAGGAGGAGGGGGAAGGGGAGGAGGAGGAGGAGGAGGAGG
CGGGGGCGGAGGCGGAGGCGGAGGCGGAGGCGTCGGGCTACCGGCGCTCGATATGATCGACCTGCACGCCATCCT
CGTGTCATCACAGGTCATCTCGTCGGTCCTCCAGGTCGACGAGCTGCTCAAGACCATGTGTGACGTGGTGCTCCA
GACTTGCGGCGGCGCAGCCACTCGGGCTGCCATCGTGGTCCAGGACAGCGACTCGTGGTGCGTCGCGGCCAGCGG
CAACCCGGAAAGGGGCGCGTCCGCTCACAAGCCGGGCCTCTCGCTATCCGGAACGGCGCTGGTGGCGGAGAACGT
GGTGCTCTACTGCACCCGCTTCCTCGAGCCCGTCTTCATCCCTGACCTGCTGGCCGACGAGCGGTTCGGAAACGT
CAACGAGGCCTGGCTGCAGCGCAACCGGCTGGGCAAGGCCATCATCGCCATCCCCATCTGTCACGGTACCAAGCC
GCTGCTCGGCGTCCTCTATCTCGAGGGCGAGCCCGGGTCGTTTACGGACCGCAACGTGACGGTGCTGCAGCTGCT
CGTCAACCAGATCGGCATCAGCTACTCCAACGCCCTCTCCATGAACAGCGTGGAAAAGATCTCGGCAGAGAACCG
GTCCATGGTCTCGGTCCAGAAGCGGGCCCTGGCCAAGGCGCTCGAGGCCGAGACCAAGGCCAAGAACGCCGAGGC
CGAGGCCAAGCGCAACGTCAAACTGGCCGAGGAGGCGGCCAAGGCCAAGAGCATCTTCCTGGCCAACGTCTCGCA
CGAGCTGCGGACGCCCCTCAACGGCGTCATCGGCAACTCGGAGCTGCTCAGGGACAGCCAGCTGAACCGGGACCA
GCTCGAGATGGCCGACTCGATCCGCGTCTCGGCCGACCTGTTGCTGACCGTCATCAACGACATCCTCGACTTTTC
CAAGATGGAGGCGGACAAGATGAAGCTGTACATGATCGCCTTCAACCCGGAGGAGATGGTGCGCGAGGTCGTCAG
GGCCGTCTCGTACAGCAACCGGGAGAAGACGTCCAAGAAGAATGTGGACATTATTCAGGACATCAAGCTGCCGCC
CATGCTCATCTACGGTGACCCGATCCGGCTGCACCAGGTGCTAGGCAACCTGATCGGCAACAGCCTCAAGTTCAC
CGAGCACGGGTCCATCACCATCGGCGCCCGCCTCGACTCGGACACGGACGAGCGGGCGACGCTGACGTTTTGGGT
CCGCGACACGGGCATCGGCATCCCGCCCCAGCAGCTGGCCAAGCTGTTCCAGCCCTTTAGCCAGGCCGACGCCAG
CACGGCCCGCAAGTACGGCGGCAGCGGACTGGGGCTGAGCATCTGCAAGTCGCTCATCGAGATGATGATGAAGGG
CAAGATCCAGCTCGAGAGCGAGGAGACGGTCGGCACCACGGCCTGGTTCACCGTGTCGTTTGAAAAGGCAAAGGC
CGACGTGGCCGCCGGGGACGCACAATCCAAGTCGTCGCCGCCCATCGACCGCTATTCGGCCACGACGTCGGCCTC
GGAGCGGGCCGCGTCGCCGAACCCGTTCCTGGACTTGACGCAGATGAGAAAGGAGGACGTACGGATCTGCGTGGC
CGAGGACAACCCCATCAACCAGAAGATTGCCATCCAGTACGCTCAGCGGCTGGGCTACCCGTCCGTCAGCGCTTA
CGAGAACGGGCTCAAGGCGGTCGAGGGACTACGGCAGAAGGCGCGCGAGGGCAAGCCGTACCACATCGTCCTCAT
GGACGTGCAGATGCCGGTGCTCGACGGCTACGAGGCCACCAAGCTGCTGCGGAGGGACGCCATGGAGGCGGTCCG
CAAGGTGCTGGTCATCGCCATGACGGCCTCGGCCATTCAGGGGGATCGGGAGAAGTGCCTGGCGGCCGGCATGAA
TGATTATCTGGCCAAACCGGTCCGGTCCGACGTGCTGCGTAGGAAGCTGGACGCCTACGTTAGCAGCGCAGTATG
TTTTCCGGACCTTTTTCTCTCCCACGCCTTCCGTACTTGCTGACCTTTCCCCCCCTTTTTTTTCCCCTCCTTTTT
ATTGGGGATTTTTTTTTAAGAGGCGCTTCTTGCCTTGCTCGCCCCCGAGCCCCCTGAATCTTCCGCGGACCGTAT
GCGAGCCCGAGACCAACGGGTCATCCGGCGGCGTCTCGCCGACGTTGGGGTACGACGGCCAAGCCGTGTCGATGT
CGATGTCGATGTCGATGCCGGTTCCGGTTCCGGTGCCGCTACCGTTGCCACTGCCACTGCCGCTGCCGGTGGCGG
TACAGGACGTGGCCCCGACGGGCCAGGCGTCTTCTAACGGGAGCCGCGCGTCGTCGTCGGATGCGGCCTCGTCGC
GAAAGAAGCAGCAACAGCAGCAGCAACAGCAGCCTCGGCGGCTGATCAAGGGTCGGGTCGGCGAGATGGAAAAGA
TGGCGGACAAGACGTCCAAGGGGGTTTCGACGACGACGACGACGACGACGACGACGATGACGGACAAGGCGACCA
AGGGGGTCTTGACTAAGAGGAGTCCTCAGCAGCACAAGACGGTGACAGACCTGACGCTGCCGCCTAGCAGCACAA
AGCGGTCACCGTCGAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail