Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|305
Gene name
Locationscaffold_107:2664..4135
Strand+
Gene length (bp)1471
Transcript length (bp)1365
Coding sequence length (bp)1362
Protein length (aa) 454

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01008 IF-2B Initiation factor 2 subunit family 3.4E-45 39 427

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT76|EI2BB_SCHPO Probable translation initiation factor eIF-2B subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif222 PE=1 SV=1 27 445 3.0E-56
sp|Q90511|EI2BB_TAKRU Translation initiation factor eIF-2B subunit beta OS=Takifugu rubripes GN=eif2b2 PE=3 SV=1 219 445 2.0E-37
sp|Q62818|EI2BB_RAT Translation initiation factor eIF-2B subunit beta OS=Rattus norvegicus GN=Eif2b2 PE=2 SV=1 219 445 1.0E-35
sp|P49770|EI2BB_HUMAN Translation initiation factor eIF-2B subunit beta OS=Homo sapiens GN=EIF2B2 PE=1 SV=3 219 445 2.0E-35
sp|Q5E9B4|EI2BB_BOVIN Translation initiation factor eIF-2B subunit beta OS=Bos taurus GN=EIF2B2 PE=2 SV=1 219 445 3.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT76|EI2BB_SCHPO Probable translation initiation factor eIF-2B subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif222 PE=1 SV=1 27 445 3.0E-56
sp|Q90511|EI2BB_TAKRU Translation initiation factor eIF-2B subunit beta OS=Takifugu rubripes GN=eif2b2 PE=3 SV=1 219 445 2.0E-37
sp|Q62818|EI2BB_RAT Translation initiation factor eIF-2B subunit beta OS=Rattus norvegicus GN=Eif2b2 PE=2 SV=1 219 445 1.0E-35
sp|P49770|EI2BB_HUMAN Translation initiation factor eIF-2B subunit beta OS=Homo sapiens GN=EIF2B2 PE=1 SV=3 219 445 2.0E-35
sp|Q5E9B4|EI2BB_BOVIN Translation initiation factor eIF-2B subunit beta OS=Bos taurus GN=EIF2B2 PE=2 SV=1 219 445 3.0E-35
sp|Q28690|EI2BB_RABIT Translation initiation factor eIF-2B subunit beta OS=Oryctolagus cuniculus GN=EIF2B2 PE=1 SV=1 219 445 5.0E-35
sp|Q54EY2|EI2BB_DICDI Translation initiation factor eIF-2B subunit beta OS=Dictyostelium discoideum GN=eif2b2 PE=3 SV=1 219 445 1.0E-34
sp|Q99LD9|EI2BB_MOUSE Translation initiation factor eIF-2B subunit beta OS=Mus musculus GN=Eif2b2 PE=1 SV=1 219 445 2.0E-34
sp|P32502|EI2BB_YEAST Translation initiation factor eIF-2B subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCD7 PE=1 SV=1 209 446 3.0E-26
sp|P32502|EI2BB_YEAST Translation initiation factor eIF-2B subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCD7 PE=1 SV=1 21 108 3.0E-13
sp|Q54EY2|EI2BB_DICDI Translation initiation factor eIF-2B subunit beta OS=Dictyostelium discoideum GN=eif2b2 PE=3 SV=1 22 104 6.0E-13
sp|Q9V281|R15PI_PYRAB Ribose 1,5-bisphosphate isomerase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB01930 PE=3 SV=1 169 426 2.0E-12
sp|Q8U4G6|R15PI_PYRFU Ribose 1,5-bisphosphate isomerase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0122 PE=3 SV=2 180 427 2.0E-12
sp|O57947|R15PI_PYRHO Ribose 1,5-bisphosphate isomerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0208 PE=3 SV=1 169 426 3.0E-11
sp|Q90511|EI2BB_TAKRU Translation initiation factor eIF-2B subunit beta OS=Takifugu rubripes GN=eif2b2 PE=3 SV=1 20 109 4.0E-11
sp|Q5JFM9|R15PI_THEKO Ribose 1,5-bisphosphate isomerase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK0185 PE=1 SV=1 180 426 7.0E-11
sp|Q54FM3|EI2BD_DICDI Translation initiation factor eIF-2B subunit delta OS=Dictyostelium discoideum GN=eif2b4 PE=3 SV=1 220 426 1.0E-10
sp|Q63186|EI2BD_RAT Translation initiation factor eIF-2B subunit delta OS=Rattus norvegicus GN=Eif2b4 PE=2 SV=1 209 426 1.0E-10
sp|Q61749|EI2BD_MOUSE Translation initiation factor eIF-2B subunit delta OS=Mus musculus GN=Eif2b4 PE=1 SV=2 209 426 3.0E-10
sp|O28242|R15PI_ARCFU Ribose 1,5-bisphosphate isomerase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_2037 PE=3 SV=1 220 426 5.0E-10
sp|Q3T058|EI2BD_BOVIN Translation initiation factor eIF-2B subunit delta OS=Bos taurus GN=EIF2B4 PE=2 SV=1 209 426 2.0E-09
sp|P49770|EI2BB_HUMAN Translation initiation factor eIF-2B subunit beta OS=Homo sapiens GN=EIF2B2 PE=1 SV=3 20 104 3.0E-09
sp|Q54I81|EI2BA_DICDI Translation initiation factor eIF-2B subunit alpha OS=Dictyostelium discoideum GN=eif2b1 PE=3 SV=1 217 426 3.0E-09
sp|P41111|EI2BD_RABIT Translation initiation factor eIF-2B subunit delta OS=Oryctolagus cuniculus GN=EIF2B4 PE=2 SV=2 245 426 3.0E-09
sp|Q57586|R15PI_METJA Ribose 1,5-bisphosphate isomerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0122 PE=3 SV=1 215 426 5.0E-09
sp|Q9UI10|EI2BD_HUMAN Translation initiation factor eIF-2B subunit delta OS=Homo sapiens GN=EIF2B4 PE=1 SV=2 204 426 1.0E-08
sp|Q28690|EI2BB_RABIT Translation initiation factor eIF-2B subunit beta OS=Oryctolagus cuniculus GN=EIF2B2 PE=1 SV=1 20 104 2.0E-08
sp|Q5E9B4|EI2BB_BOVIN Translation initiation factor eIF-2B subunit beta OS=Bos taurus GN=EIF2B2 PE=2 SV=1 1 104 3.0E-08
sp|Q64270|EI2BA_RAT Translation initiation factor eIF-2B subunit alpha OS=Rattus norvegicus GN=Eif2b1 PE=2 SV=1 228 382 3.0E-08
sp|Q99LC8|EI2BA_MOUSE Translation initiation factor eIF-2B subunit alpha OS=Mus musculus GN=Eif2b1 PE=1 SV=1 228 382 7.0E-08
sp|Q0IIF2|EI2BA_BOVIN Translation initiation factor eIF-2B subunit alpha OS=Bos taurus GN=EIF2B1 PE=2 SV=1 228 382 8.0E-08
sp|Q99LD9|EI2BB_MOUSE Translation initiation factor eIF-2B subunit beta OS=Mus musculus GN=Eif2b2 PE=1 SV=1 1 104 1.0E-07
sp|Q4R4V8|EI2BA_MACFA Translation initiation factor eIF-2B subunit alpha OS=Macaca fascicularis GN=EIF2B1 PE=2 SV=1 228 382 3.0E-07
sp|D4GV73|R15PI_HALVD Ribose 1,5-bisphosphate isomerase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=HVO_0966 PE=1 SV=1 219 443 5.0E-07
sp|Q62818|EI2BB_RAT Translation initiation factor eIF-2B subunit beta OS=Rattus norvegicus GN=Eif2b2 PE=2 SV=1 20 104 1.0E-06
sp|Q5RAR0|EI2BA_PONAB Translation initiation factor eIF-2B subunit alpha OS=Pongo abelii GN=EIF2B1 PE=2 SV=2 228 382 1.0E-06
sp|Q14232|EI2BA_HUMAN Translation initiation factor eIF-2B subunit alpha OS=Homo sapiens GN=EIF2B1 PE=1 SV=1 228 382 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0044237 cellular metabolic process Yes
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|305
MPSAAAGHAPDLENYLKSLKSQSLEAAIERLISLLKRRQIRGSEACAVATAHILLQVVARAKWQDADGLLEKVCA
TGRRLVEAQPTELVVANIVRRVLALIRDEAAEDRNEPSSEAPSEAPFTPTDGSTPARSWSPPQTVARQDSAGDLA
SPSATSHVPSRAGLFPSYSSANLPKTLFHLLSASPPSDVVTSMPSSFRNSGTSTPTGRGGQANSQENTLRSEVID
GIEEILDEISQVDDQIAAQAEAQIHPGDHVLIHRLSPSVERFILRAALKRRFTVLMTAEAPRVRKHQDSQAMAAF
QKRLSTAGIPAIVLRSAALTAYMPRIDKVVLSARAILANGGVVAESGAATVARAAKEAGSAVVALAGVYKLSPEH
PSDEESVIEWASPSTYVGFDDGPLVEGIEVRTAATELVPPGLVDMYMTNLGTHSRDHLASLIADHYNQEDAGFHL
PSDG
Coding >Ophio5|305
ATGCCATCGGCCGCTGCGGGCCACGCGCCCGATCTCGAAAATTACCTCAAGTCGCTCAAGAGCCAATCGCTGGAA
GCAGCCATCGAGAGACTCATATCCCTCCTGAAGCGTCGACAGATCCGCGGTTCCGAAGCCTGCGCCGTCGCTACC
GCCCATATCCTTTTACAGGTCGTCGCCAGAGCCAAGTGGCAGGATGCCGACGGCTTGCTCGAAAAAGTCTGCGCC
ACGGGCCGTCGTCTGGTCGAGGCACAGCCGACGGAACTGGTTGTTGCCAACATCGTTCGTCGCGTCCTCGCTTTG
ATTCGCGATGAGGCAGCAGAGGATCGAAATGAGCCGTCGAGCGAGGCTCCCAGCGAGGCGCCCTTTACGCCAACA
GATGGCTCGACTCCGGCCCGGAGCTGGTCGCCGCCTCAGACGGTCGCCAGGCAGGACTCGGCTGGTGACTTGGCC
TCGCCTTCCGCGACTTCACATGTGCCGTCTCGCGCTGGTCTTTTCCCGTCGTATAGCTCGGCCAACCTGCCCAAG
ACGTTGTTCCACCTGCTGTCCGCGTCGCCTCCGTCCGACGTCGTCACCTCTATGCCCTCCTCGTTTCGAAACTCG
GGCACCTCCACACCCACCGGCAGAGGCGGTCAGGCCAACAGCCAGGAGAACACGCTTCGGTCCGAGGTCATCGAC
GGCATCGAGGAGATACTCGACGAAATCAGCCAGGTCGATGACCAGATCGCCGCCCAGGCCGAGGCGCAGATCCAC
CCGGGAGACCACGTCCTCATCCACCGTCTCTCGCCCTCCGTCGAGCGCTTCATTCTCCGCGCCGCTCTCAAGCGC
CGCTTCACCGTCCTCATGACGGCCGAGGCGCCTCGCGTCCGGAAACACCAGGACTCCCAGGCCATGGCCGCCTTT
CAAAAGAGGCTCTCCACAGCCGGCATCCCGGCCATCGTCCTTCGGAGCGCAGCCCTGACAGCCTACATGCCACGC
ATCGACAAAGTCGTTCTCAGCGCACGCGCCATCTTAGCCAATGGCGGCGTCGTCGCCGAGTCCGGCGCGGCGACG
GTAGCACGCGCTGCCAAGGAAGCCGGCAGCGCCGTCGTCGCCCTCGCCGGCGTCTACAAACTCAGCCCGGAGCAT
CCGTCGGACGAGGAGTCGGTCATCGAATGGGCCAGTCCGTCGACGTATGTCGGCTTCGACGACGGGCCCCTGGTC
GAGGGGATCGAGGTCCGGACCGCGGCGACGGAGCTGGTGCCGCCCGGGCTCGTTGACATGTACATGACGAACCTG
GGGACGCACTCGCGTGATCACTTGGCCAGTCTCATCGCGGACCACTACAATCAGGAGGATGCTGGCTTCCATCTG
CCCAGCGACGGA
Transcript >Ophio5|305
ATGCCATCGGCCGCTGCGGGCCACGCGCCCGATCTCGAAAATTACCTCAAGTCGCTCAAGAGCCAATCGCTGGAA
GCAGCCATCGAGAGACTCATATCCCTCCTGAAGCGTCGACAGATCCGCGGTTCCGAAGCCTGCGCCGTCGCTACC
GCCCATATCCTTTTACAGGTCGTCGCCAGAGCCAAGTGGCAGGATGCCGACGGCTTGCTCGAAAAAGTCTGCGCC
ACGGGCCGTCGTCTGGTCGAGGCACAGCCGACGGAACTGGTTGTTGCCAACATCGTTCGTCGCGTCCTCGCTTTG
ATTCGCGATGAGGCAGCAGAGGATCGAAATGAGCCGTCGAGCGAGGCTCCCAGCGAGGCGCCCTTTACGCCAACA
GATGGCTCGACTCCGGCCCGGAGCTGGTCGCCGCCTCAGACGGTCGCCAGGCAGGACTCGGCTGGTGACTTGGCC
TCGCCTTCCGCGACTTCACATGTGCCGTCTCGCGCTGGTCTTTTCCCGTCGTATAGCTCGGCCAACCTGCCCAAG
ACGTTGTTCCACCTGCTGTCCGCGTCGCCTCCGTCCGACGTCGTCACCTCTATGCCCTCCTCGTTTCGAAACTCG
GGCACCTCCACACCCACCGGCAGAGGCGGTCAGGCCAACAGCCAGGAGAACACGCTTCGGTCCGAGGTCATCGAC
GGCATCGAGGAGATACTCGACGAAATCAGCCAGGTCGATGACCAGATCGCCGCCCAGGCCGAGGCGCAGATCCAC
CCGGGAGACCACGTCCTCATCCACCGTCTCTCGCCCTCCGTCGAGCGCTTCATTCTCCGCGCCGCTCTCAAGCGC
CGCTTCACCGTCCTCATGACGGCCGAGGCGCCTCGCGTCCGGAAACACCAGGACTCCCAGGCCATGGCCGCCTTT
CAAAAGAGGCTCTCCACAGCCGGCATCCCGGCCATCGTCCTTCGGAGCGCAGCCCTGACAGCCTACATGCCACGC
ATCGACAAAGTCGTTCTCAGCGCACGCGCCATCTTAGCCAATGGCGGCGTCGTCGCCGAGTCCGGCGCGGCGACG
GTAGCACGCGCTGCCAAGGAAGCCGGCAGCGCCGTCGTCGCCCTCGCCGGCGTCTACAAACTCAGCCCGGAGCAT
CCGTCGGACGAGGAGTCGGTCATCGAATGGGCCAGTCCGTCGACGTATGTCGGCTTCGACGACGGGCCCCTGGTC
GAGGGGATCGAGGTCCGGACCGCGGCGACGGAGCTGGTGCCGCCCGGGCTCGTTGACATGTACATGACGAACCTG
GGGACGCACTCGCGTGATCACTTGGCCAGTCTCATCGCGGACCACTACAATCAGGAGGATGCTGGCTTCCATCTG
CCCAGCGACGGATAA
Gene >Ophio5|305
ATGCCATCGGCCGCTGCGGGCCACGCGCCCGATCTCGAAAATTACCTCAAGTCGCTCAAGAGCCAATCGCTGGAA
GCAGCCATCGAGAGACTCATATCGTACGTCCGAGAGGCTCACACGACTCTTTTCCTCTTTTGACCACAGCGTTGC
AGCCTCCTGAAGCGTCGACAGATCCGCGGTTCCGAAGCCTGCGCCGTCGCTACCGCCCATATCCTTTTACAGGTC
GTCGCCAGAGCCAAGTGGCAGGATGCCGACGGCTTGCTCGAAAAAGTCTGCGCCACGGGCCGTCGTCTGGTCGAG
GCACAGCCGACGGAACTGGTTGTTGCCAACATCGTTCGTCGCGTCCTCGCTTTGATTCGCGATGAGGCAGCAGAG
GATCGAAATGAGCCGTCGAGCGAGGCTCCCAGCGAGGCGCCCTTTACGCCAACAGATGGCTCGACTCCGGCCCGG
AGCTGGTCGCCGCCTCAGACGGTCGCCAGGCAGGACTCGGCTGGTGACTTGGCCTCGCCTTCCGCGACTTCACAT
GTGCCGTCTCGCGCTGGTCTTTTCCCGTCGTATAGCTCGGCCAACCTGCCCAAGACGTTGTTCCACCTGCTGTCC
GCGTCGCCTCCGTCCGACGTCGTCACCTCTATGCCCTCCTCGTTTCGAAACTCGGGCACCTCCACACCCACCGGC
AGAGGCGGTCAGGCCAACAGCCAGGAGAACACGCTTCGGTCCGAGGTCATCGACGGCATCGAGGAGATACTCGAC
GAAATCAGCCAGGTCGATGACCAGATCGCCGCCCAGGCCGAGGCGCAGATCCACCCGGGAGACCACGTCCTCATC
CACCGTCTCTCGCCCTCCGTCGAGCGCTTCATTCTCCGCGCCGCTCTCAAGCGCCGCTTCACCGTCCTCATGACG
GCCGAGGCGCCTCGCGTCCGGAAACACCAGGACTCCCAGGCCATGGCCGCCTTTCAAAAGAGGCTCTCCACAGCC
GGCATCCCGGCCATCGTCCTTCGGAGCGCAGCCCTGACAGCCTACATGCCACGCATCGACAAAGTCGTTCTCAGC
GCACGCGCCATCTTAGCCAATGGCGGCGTCGTCGCCGAGTCCGGCGCGGCGACGGTAGCACGCGCTGCCAAGGAA
GCCGGCAGCGCCGTCGTCGCCCTCGCCGGCGTCTACAAACTCAGCCCGGAGCATCCGTCGGACGAGGAGTCGGTC
ATCGAATGGGCCAGTCCGTCGACGTATGTCGGCTTCGACGACGGGCCCCTGGTCGAGGGGATCGAGGTCCGGACC
GCGGCGACGGAGCTGGTGCCGCCCGGGCTCGTTGACATGTACATGACGAACCTGTAAGTGTCGAATGCTTAGCCA
TCTGCACTTCCCGGCTGACTTGATTTTCAGGGGGACGCACTCGCGTGATCACTTGGCCAGTCTCATCGCGGACCA
CTACAATCAGGAGGATGCTGGCTTCCATCTGCCCAGCGACGGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail