Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3040
Gene name
Locationscaffold_241:5319..7069
Strand+
Gene length (bp)1750
Transcript length (bp)1608
Coding sequence length (bp)1605
Protein length (aa) 535

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00251 Glyco_hydro_32N Glycosyl hydrolases family 32 N-terminal domain 7.5E-80 51 353
PF08244 Glyco_hydro_32C Glycosyl hydrolases family 32 C terminal 8.9E-08 415 516

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P00724|INV2_YEAST Invertase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUC2 PE=1 SV=1 47 502 4.0E-99
sp|P28999|INU1_KLUMA Inulinase OS=Kluyveromyces marxianus GN=INU1 PE=1 SV=1 47 503 5.0E-99
sp|P10596|INV4_YEASX Invertase 4 OS=Saccharomyces cerevisiae GN=SUC4 PE=3 SV=1 16 502 5.0E-98
sp|P10594|INV1_YEASX Invertase 1 OS=Saccharomyces cerevisiae GN=SUC1 PE=1 SV=1 47 502 8.0E-97
sp|Q6BJW6|INV_DEBHA Invertase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INV PE=3 SV=2 10 505 2.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P00724|INV2_YEAST Invertase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUC2 PE=1 SV=1 47 502 4.0E-99
sp|P28999|INU1_KLUMA Inulinase OS=Kluyveromyces marxianus GN=INU1 PE=1 SV=1 47 503 5.0E-99
sp|P10596|INV4_YEASX Invertase 4 OS=Saccharomyces cerevisiae GN=SUC4 PE=3 SV=1 16 502 5.0E-98
sp|P10594|INV1_YEASX Invertase 1 OS=Saccharomyces cerevisiae GN=SUC1 PE=1 SV=1 47 502 8.0E-97
sp|Q6BJW6|INV_DEBHA Invertase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INV PE=3 SV=2 10 505 2.0E-95
sp|P40912|INV1_WICAO Invertase OS=Wickerhamomyces anomalus GN=INV1 PE=3 SV=1 36 515 5.0E-95
sp|A5DHM6|INUE_PICGU Extracellular exo-inulinase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_02777 PE=1 SV=2 47 515 2.0E-93
sp|A8W7I5|INUE_PICGM Extracellular exo-inulinase inuE OS=Meyerozyma guilliermondii PE=1 SV=3 47 515 2.0E-92
sp|Q9Y746|INV_KLULA Invertase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=INV1 PE=3 SV=1 47 530 2.0E-91
sp|O59852|INV1_SCHPO Invertase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=inv1 PE=1 SV=1 42 535 1.0E-89
sp|O42878|INVX_SCHPO Putative invertase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC8E11.01c PE=3 SV=3 45 507 6.0E-89
sp|A2R0E0|INUE_ASPNC Extracellular exo-inulinase inuE OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=inuE PE=2 SV=1 21 535 8.0E-82
sp|Q76HP6|INUE_ASPNG Extracellular exo-inulinase inuE OS=Aspergillus niger GN=inuE PE=1 SV=1 21 535 6.0E-81
sp|E1ABX2|INUE_ASPFI Extracellular exo-inulinase inuE OS=Aspergillus ficuum GN=exoI PE=1 SV=1 21 535 6.0E-81
sp|P24133|INV_SCHOC Invertase OS=Schwanniomyces occidentalis GN=INV PE=1 SV=1 21 532 1.0E-79
sp|P05656|SACC_BACSU Levanase OS=Bacillus subtilis (strain 168) GN=sacC PE=1 SV=1 11 534 1.0E-78
sp|Q96TU3|INUE_ASPAW Extracellular exo-inulinase inuE OS=Aspergillus awamori GN=inuE PE=1 SV=1 22 535 6.0E-78
sp|O31411|SACC_BACL7 Levanase (Fragment) OS=Bacillus sp. (strain L7) PE=1 SV=2 39 534 7.0E-52
sp|O74641|INUA_ASPNG Extracellular endo-inulinase inuA OS=Aspergillus niger GN=inuA PE=1 SV=1 16 354 8.0E-45
sp|O94220|INU2_ASPFI Extracellular endo-inulinase inu2 OS=Aspergillus ficuum GN=inu2 PE=1 SV=1 16 354 2.0E-44
sp|O74642|INUB_ASPNG Extracellular endo-inulinase inuB OS=Aspergillus niger GN=inuB PE=1 SV=1 16 354 1.0E-43
sp|A5ABL2|INUA_ASPNC Extracellular endo-inulinase inuA OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=inuA PE=1 SV=1 16 354 3.0E-43
sp|O07003|LEVB_BACSU Levanbiose-producing levanase OS=Bacillus subtilis (strain 168) GN=levB PE=1 SV=1 24 365 1.0E-42
sp|P94469|LEVB_GEOSE Levanbiose-producing levanase (Fragment) OS=Geobacillus stearothermophilus GN=levB PE=1 SV=2 70 365 3.0E-38
sp|O33833|BFRA_THEMA Beta-fructosidase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=bfrA PE=1 SV=1 46 348 8.0E-38
sp|Q03174|FRUA_STRMU Fructan beta-fructosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=fruA PE=2 SV=2 42 534 9.0E-30
sp|P0DJA7|SCR_ZYMMO Sucrose-6-phosphate hydrolase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=sacA PE=1 SV=1 43 531 9.0E-27
sp|P07819|SCRB_BACSU Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) GN=sacA PE=3 SV=2 43 365 1.0E-26
sp|F8DVG5|SCR_ZYMMA Sucrose-6-phosphate hydrolase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1) GN=sacA PE=3 SV=1 43 531 2.0E-26
sp|P16553|RAFD_ECOLX Raffinose invertase OS=Escherichia coli GN=rafD PE=3 SV=1 48 349 2.0E-25
sp|Q43348|INVA3_ARATH Acid beta-fructofuranosidase 3, vacuolar OS=Arabidopsis thaliana GN=BFRUCT3 PE=2 SV=1 47 351 5.0E-23
sp|P80065|INVB_DAUCA Beta-fructofuranosidase, soluble isoenzyme I OS=Daucus carota GN=INV*DC4 PE=1 SV=2 47 353 5.0E-23
sp|P29000|INVA_SOLLC Acid beta-fructofuranosidase OS=Solanum lycopersicum GN=TIV1 PE=2 SV=1 47 389 1.0E-22
sp|P49174|INVA_MAIZE Beta-fructofuranosidase, cell wall isozyme OS=Zea mays PE=2 SV=1 35 351 2.0E-22
sp|P27217|SCRB_KLEPN Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae GN=scrB PE=1 SV=3 19 506 3.0E-22
sp|Q39041|INVA4_ARATH Acid beta-fructofuranosidase 4, vacuolar OS=Arabidopsis thaliana GN=BFRUCT4 PE=2 SV=2 47 367 3.0E-22
sp|P37075|SCRB_SALTM Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium GN=scrB PE=3 SV=1 19 521 5.0E-22
sp|A1STJ9|SCRB_PSYIN Probable sucrose-6-phosphate hydrolase OS=Psychromonas ingrahamii (strain 37) GN=Ping_0974 PE=3 SV=1 42 350 6.0E-22
sp|P29001|INVA_VIGRR Acid beta-fructofuranosidase OS=Vigna radiata var. radiata GN=INVA PE=1 SV=1 25 507 6.0E-22
sp|P40714|CSCA_ECOLX Sucrose-6-phosphate hydrolase OS=Escherichia coli GN=cscA PE=3 SV=1 46 401 8.0E-22
sp|P93761|INV1_CAPAN Acid beta-fructofuranosidase AIV-18 OS=Capsicum annuum PE=2 SV=1 47 353 1.0E-21
sp|P49175|INV1_MAIZE Beta-fructofuranosidase 1 OS=Zea mays GN=IVR1 PE=3 SV=1 47 523 1.0E-21
sp|Q43089|INV1_PEA Beta-fructofuranosidase, cell wall isozyme OS=Pisum sativum GN=BFRUCT1 PE=2 SV=1 45 351 1.0E-21
sp|O24509|INVA_PHAVU Acid beta-fructofuranosidase OS=Phaseolus vulgaris PE=2 SV=1 47 507 2.0E-21
sp|Q0JDC6|INV3_ORYSJ Beta-fructofuranosidase, insoluble isoenzyme 3 OS=Oryza sativa subsp. japonica GN=CIN3 PE=2 SV=1 36 352 3.0E-21
sp|Q43857|INVA_VICFA Acid beta-fructofuranosidase OS=Vicia faba GN=VCINV PE=2 SV=1 47 365 3.0E-21
sp|Q70XE6|6FEH_BETVU Fructan 6-exohydrolase OS=Beta vulgaris GN=6-FEH PE=1 SV=1 45 525 3.0E-21
sp|Q01IS8|INV3_ORYSI Beta-fructofuranosidase, insoluble isoenzyme 3 OS=Oryza sativa subsp. indica GN=CIN3 PE=2 SV=2 36 352 3.0E-21
sp|Q43866|INV1_ARATH Beta-fructofuranosidase, insoluble isoenzyme CWINV1 OS=Arabidopsis thaliana GN=CWINV1 PE=1 SV=1 41 365 1.0E-20
sp|Q5JJV0|INV4_ORYSJ Beta-fructofuranosidase, insoluble isoenzyme 4 OS=Oryza sativa subsp. japonica GN=CIN4 PE=2 SV=1 21 443 2.0E-20
sp|Q67XZ3|INV3_ARATH Beta-fructofuranosidase, insoluble isoenzyme CWINV3 OS=Arabidopsis thaliana GN=CWINV3 PE=1 SV=2 12 353 2.0E-20
sp|Q9LIB9|INV5_ARATH Beta-fructofuranosidase, insoluble isoenzyme CWINV5 OS=Arabidopsis thaliana GN=CWINV5 PE=2 SV=2 13 365 2.0E-19
sp|A5EZZ8|SCRB_VIBC3 Probable sucrose-6-phosphate hydrolase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=cscA PE=3 SV=1 45 239 7.0E-19
sp|Q0E0P0|INV1_ORYSJ Beta-fructofuranosidase, insoluble isoenzyme 1 OS=Oryza sativa subsp. japonica GN=CIN1 PE=2 SV=1 35 240 2.0E-18
sp|Q56660|SCRB_VIBCL Probable sucrose-6-phosphate hydrolase OS=Vibrio cholerae PE=3 SV=1 45 239 2.0E-18
sp|A2X5P7|INV1_ORYSI Beta-fructofuranosidase, insoluble isoenzyme 1 OS=Oryza sativa subsp. indica GN=CIN1 PE=2 SV=2 35 240 4.0E-18
sp|Q9KLT6|SCRB_VIBCH Probable sucrose-6-phosphate hydrolase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=VC_A0655 PE=3 SV=1 26 239 7.0E-18
sp|Q39693|INV3_DAUCA Beta-fructofuranosidase, insoluble isoenzyme 3 OS=Daucus carota GN=INV3 PE=3 SV=1 46 431 1.0E-17
sp|Q01IS7|INV2_ORYSI Beta-fructofuranosidase, insoluble isoenzyme 2 OS=Oryza sativa subsp. indica GN=CIN2 PE=2 SV=2 15 458 1.0E-17
sp|Q1PEF8|INV2_ARATH Beta-fructofuranosidase, insoluble isoenzyme CWINV2 OS=Arabidopsis thaliana GN=CWINV2 PE=2 SV=1 36 251 2.0E-17
sp|Q0JDC5|INV2_ORYSJ Beta-fructofuranosidase, insoluble isoenzyme 2 OS=Oryza sativa subsp. japonica GN=CIN2 PE=1 SV=1 15 458 4.0E-17
sp|Q0J360|INV7_ORYSJ Beta-fructofuranosidase, insoluble isoenzyme 7 OS=Oryza sativa subsp. japonica GN=CIN7 PE=2 SV=1 21 353 6.0E-17
sp|B6DZD0|1FEH_TRIUA Fructan 1-exohydrolase OS=Triticum urartu GN=1-FEH PE=3 SV=1 23 243 6.0E-17
sp|A2YZ01|INV7_ORYSI Beta-fructofuranosidase, insoluble isoenzyme 7 OS=Oryza sativa subsp. indica GN=CIN7 PE=2 SV=2 5 353 6.0E-17
sp|B6DZC8|1FEH3_WHEAT Fructan 1-exohydrolase w3 OS=Triticum aestivum GN=1-FEHw3 PE=1 SV=1 22 243 7.0E-17
sp|B6DZD1|1FEH_AEGSP Fructan 1-exohydrolase OS=Aegilops speltoides GN=1-FEH PE=3 SV=1 46 243 8.0E-17
sp|Q8W413|INV4_ARATH Beta-fructofuranosidase, insoluble isoenzyme CWINV4 OS=Arabidopsis thaliana GN=CWINV4 PE=2 SV=1 36 255 4.0E-16
sp|P13394|SCRB_VIBAL Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus GN=scrB PE=2 SV=1 48 502 5.0E-16
sp|Q84LA1|1FEH2_WHEAT Fructan 1-exohydrolase w2 OS=Triticum aestivum GN=1-FEHw2 PE=1 SV=1 23 243 6.0E-16
sp|B6DZD2|1FEH_AEGTA Fructan 1-exohydrolase OS=Aegilops tauschii GN=1-FEH PE=3 SV=1 23 243 7.0E-16
sp|Q84PN8|1FEH1_WHEAT Fructan 1-exohydrolase w1 OS=Triticum aestivum GN=1-FEHw1 PE=1 SV=1 23 243 9.0E-16
sp|P26792|INV1_DAUCA Beta-fructofuranosidase, insoluble isoenzyme 1 OS=Daucus carota GN=INV1 PE=1 SV=1 36 243 1.0E-15
sp|Q39692|INV2_DAUCA Beta-fructofuranosidase, insoluble isoenzyme 2 OS=Daucus carota GN=INV2 PE=3 SV=1 10 237 2.0E-15
sp|Q70AT7|1FEH_HORVU Fructan 1-exohydrolase OS=Hordeum vulgare GN=1-FEH PE=2 SV=1 46 240 5.0E-15
sp|Q5FC15|GFT_ASPOF 6(G)-fructosyltransferase OS=Asparagus officinalis GN=FT1 PE=1 SV=1 47 459 9.0E-15
sp|P43471|SCRB_PEDPE Sucrose-6-phosphate hydrolase OS=Pediococcus pentosaceus GN=scrB PE=3 SV=2 34 502 2.0E-14
sp|D2IGW7|1FEH_BROPI Fructan 1-exohydrolase OS=Bromus pictus GN=1-FEHa PE=1 SV=1 46 243 1.0E-13
sp|B6DXP5|1FEH_LEYCH Fructan 1-exohydrolase OS=Leymus chinensis GN=1-FEH PE=2 SV=1 22 243 2.0E-13
sp|Q2UXF7|6FEH_WHEAT Fructan 6-exohydrolase OS=Triticum aestivum GN=6-FEH PE=1 SV=1 6 240 7.0E-13
sp|Q9FSV7|SST_FESAR Sucrose:sucrose 1-fructosyltransferase OS=Festuca arundinacea GN=1-SST PE=1 SV=1 47 383 7.0E-13
sp|P92916|GFT_ALLCE Bifunctional 6(G)-fructosyltransferase/2,1-fructan:2,1-fructan 1-fructosyltransferase OS=Allium cepa PE=1 SV=1 47 193 2.0E-12
sp|Q04937|SCRB_LACLL Sucrose-6-phosphate hydrolase OS=Lactococcus lactis subsp. lactis GN=scrB PE=1 SV=1 43 243 3.0E-12
sp|Q56UD0|INV6_ORYSJ Beta-fructofuranosidase, insoluble isoenzyme 6 OS=Oryza sativa subsp. japonica GN=CIN6 PE=2 SV=1 47 255 7.0E-12
sp|Q56UD1|INV5_ORYSJ Beta-fructofuranosidase, insoluble isoenzyme 5 OS=Oryza sativa subsp. japonica GN=CIN5 PE=2 SV=3 47 220 1.0E-09
sp|P07635|INV7_YEASX Invertase 7 (Fragments) OS=Saccharomyces cerevisiae GN=SUC7 PE=3 SV=1 16 87 2.0E-08
sp|P10597|INV5_YEASX Invertase 5 (Fragment) OS=Saccharomyces cerevisiae GN=SUC5 PE=3 SV=1 47 87 2.0E-08
sp|P10595|INV3_YEASX Invertase 3 (Fragment) OS=Saccharomyces cerevisiae GN=SUC3 PE=3 SV=1 47 87 2.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 40 0.45

Transmembrane Domains

Domain # Start End Length
1 12 34 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3040
MQLSFARRQMRACIHILNMALPLLLAVAAAMLLFPSAAADSYSGPYRPQVHYSPPRNFMNDPNGLFRAADGTWHL
YYQYNPTGLVAGNQHWGHATSPDLYHWTNRPIALSPPNNRTFVWSGSAVVDVNNTSGFFPDRKDGVIAIYTLASS
DRQSQAISYSHDGGYTFTPYDGNPVIPGGNSSQFRDPKVIWHDGRWVMTVSYPVDFAVGIFTSHNLVDWDPVSNF
SLHGLLGLQWECPNLVRVPYVDHDTGARLDDMWLMVVSVNPGSPLGGSVTQYFPGTFNGTHFEAVDSAVRFADFA
KDYYAGQFYYGLPDREAVFIAWASNWQYAEAVPTAQEGWRSAMSLPRRTALTKVPRLGWKLVSQPYDLSPVLGQD
LVSQTGLTNHSLALDFAHVPSNALYWEANVTGLPPTSALSAAASLNFTFASSHSGERLSSGYHLATEAFFLDRGQ
LRGFQSPFFTDKFSLDAPPRSGSSWSITGVFDRSLVEVFLDRGVDSATTIFFAQQPLTTMVIASSGLPDEARVSV
RVKALRSVWN
Coding >Ophio5|3040
ATGCAACTTTCTTTCGCCCGCAGGCAGATGCGAGCATGCATACATATACTGAACATGGCTCTTCCTCTTCTGCTG
GCCGTCGCGGCCGCCATGCTATTATTCCCCAGCGCCGCCGCCGACTCTTACAGCGGGCCGTATCGGCCCCAGGTC
CACTACTCGCCGCCGCGCAACTTCATGAACGACCCCAACGGCCTTTTCCGCGCCGCTGACGGCACCTGGCACCTT
TACTATCAGTATAACCCCACCGGCCTCGTCGCCGGGAACCAGCATTGGGGCCACGCCACGTCGCCCGACCTCTAC
CACTGGACCAATCGGCCCATCGCCCTGTCGCCGCCTAACAACCGAACCTTTGTATGGTCCGGGAGCGCCGTCGTC
GACGTCAACAACACGTCGGGCTTCTTCCCGGACAGGAAAGACGGCGTCATCGCCATATACACGCTCGCCAGCTCA
GACCGCCAGTCTCAGGCCATCTCCTACTCCCACGATGGCGGCTACACCTTCACCCCCTATGACGGAAACCCCGTC
ATCCCCGGCGGCAACTCGTCGCAGTTTCGTGACCCTAAAGTCATCTGGCATGACGGCCGCTGGGTCATGACCGTC
TCCTACCCCGTCGACTTCGCCGTTGGCATCTTCACCTCACACAATCTCGTAGACTGGGACCCCGTAAGCAACTTT
TCCCTCCACGGCCTGCTCGGCCTTCAGTGGGAGTGCCCCAACCTTGTCCGCGTGCCGTACGTGGACCATGATACG
GGCGCCCGCCTCGACGACATGTGGCTCATGGTCGTCTCCGTAAACCCCGGCAGTCCGCTCGGAGGATCCGTCACT
CAGTACTTCCCGGGCACCTTTAACGGCACCCATTTTGAGGCCGTTGACTCGGCTGTGCGCTTCGCCGACTTCGCC
AAGGACTATTACGCCGGCCAGTTTTACTACGGCCTACCCGACCGAGAGGCCGTCTTCATCGCATGGGCCTCCAAT
TGGCAGTACGCCGAAGCCGTGCCCACAGCTCAAGAAGGCTGGAGATCCGCCATGAGCCTCCCGCGTCGCACCGCC
CTGACCAAGGTCCCCCGCCTCGGATGGAAGCTCGTCTCTCAGCCGTACGACCTGAGCCCCGTCCTAGGCCAAGAC
CTCGTCTCCCAGACCGGGCTCACCAACCATTCCCTGGCCCTCGACTTTGCCCACGTCCCGTCCAACGCCTTGTAC
TGGGAGGCCAACGTCACGGGTCTGCCTCCCACCAGTGCGCTATCGGCCGCCGCAAGCCTCAACTTCACCTTTGCC
AGCAGCCACAGCGGCGAGCGCCTCTCGAGCGGATACCATTTGGCGACTGAAGCCTTTTTCCTCGATAGGGGCCAG
CTCCGTGGCTTCCAGAGCCCATTCTTCACCGACAAGTTCTCCCTTGACGCGCCGCCGCGTTCGGGCAGCTCGTGG
AGCATCACCGGCGTCTTCGACCGCTCCTTGGTCGAGGTCTTCCTCGACAGAGGCGTCGACAGCGCCACGACCATC
TTCTTCGCACAACAGCCCCTGACCACCATGGTGATTGCCTCGTCGGGGCTCCCGGACGAGGCACGCGTCAGCGTC
CGCGTCAAGGCCCTTCGGAGCGTCTGGAAC
Transcript >Ophio5|3040
ATGCAACTTTCTTTCGCCCGCAGGCAGATGCGAGCATGCATACATATACTGAACATGGCTCTTCCTCTTCTGCTG
GCCGTCGCGGCCGCCATGCTATTATTCCCCAGCGCCGCCGCCGACTCTTACAGCGGGCCGTATCGGCCCCAGGTC
CACTACTCGCCGCCGCGCAACTTCATGAACGACCCCAACGGCCTTTTCCGCGCCGCTGACGGCACCTGGCACCTT
TACTATCAGTATAACCCCACCGGCCTCGTCGCCGGGAACCAGCATTGGGGCCACGCCACGTCGCCCGACCTCTAC
CACTGGACCAATCGGCCCATCGCCCTGTCGCCGCCTAACAACCGAACCTTTGTATGGTCCGGGAGCGCCGTCGTC
GACGTCAACAACACGTCGGGCTTCTTCCCGGACAGGAAAGACGGCGTCATCGCCATATACACGCTCGCCAGCTCA
GACCGCCAGTCTCAGGCCATCTCCTACTCCCACGATGGCGGCTACACCTTCACCCCCTATGACGGAAACCCCGTC
ATCCCCGGCGGCAACTCGTCGCAGTTTCGTGACCCTAAAGTCATCTGGCATGACGGCCGCTGGGTCATGACCGTC
TCCTACCCCGTCGACTTCGCCGTTGGCATCTTCACCTCACACAATCTCGTAGACTGGGACCCCGTAAGCAACTTT
TCCCTCCACGGCCTGCTCGGCCTTCAGTGGGAGTGCCCCAACCTTGTCCGCGTGCCGTACGTGGACCATGATACG
GGCGCCCGCCTCGACGACATGTGGCTCATGGTCGTCTCCGTAAACCCCGGCAGTCCGCTCGGAGGATCCGTCACT
CAGTACTTCCCGGGCACCTTTAACGGCACCCATTTTGAGGCCGTTGACTCGGCTGTGCGCTTCGCCGACTTCGCC
AAGGACTATTACGCCGGCCAGTTTTACTACGGCCTACCCGACCGAGAGGCCGTCTTCATCGCATGGGCCTCCAAT
TGGCAGTACGCCGAAGCCGTGCCCACAGCTCAAGAAGGCTGGAGATCCGCCATGAGCCTCCCGCGTCGCACCGCC
CTGACCAAGGTCCCCCGCCTCGGATGGAAGCTCGTCTCTCAGCCGTACGACCTGAGCCCCGTCCTAGGCCAAGAC
CTCGTCTCCCAGACCGGGCTCACCAACCATTCCCTGGCCCTCGACTTTGCCCACGTCCCGTCCAACGCCTTGTAC
TGGGAGGCCAACGTCACGGGTCTGCCTCCCACCAGTGCGCTATCGGCCGCCGCAAGCCTCAACTTCACCTTTGCC
AGCAGCCACAGCGGCGAGCGCCTCTCGAGCGGATACCATTTGGCGACTGAAGCCTTTTTCCTCGATAGGGGCCAG
CTCCGTGGCTTCCAGAGCCCATTCTTCACCGACAAGTTCTCCCTTGACGCGCCGCCGCGTTCGGGCAGCTCGTGG
AGCATCACCGGCGTCTTCGACCGCTCCTTGGTCGAGGTCTTCCTCGACAGAGGCGTCGACAGCGCCACGACCATC
TTCTTCGCACAACAGCCCCTGACCACCATGGTGATTGCCTCGTCGGGGCTCCCGGACGAGGCACGCGTCAGCGTC
CGCGTCAAGGCCCTTCGGAGCGTCTGGAACTGA
Gene >Ophio5|3040
ATGCAACTTTCTTTCGCCCGCAGGCAGATGCGAGCATGCATACATATGTAATACCACTCCAGAATAATTTATACC
CATTTCTCGACAACTCTGACAGCCTCATCCTCCTCCTCTCTTAGACTGAACATGGCTCTTCCTCTTCTGCTGGCC
GTCGCGGCCGCCATGCTATTATTCCCCAGCGCCGCCGCCGACTCTTACAGCGGGCCGTATCGGCCCCAGGTCCAC
TACTCGCCGCCGCGCAACTTCATGAACGACCCCAACGGCCTTTTCCGCGCCGCTGACGGCACCTGGCACCTTTAC
TATCAGTATAACCCCACCGGCCTCGTCGCCGGGAACCAGCATTGGGGCCACGCCACGTCGCCCGACCTCTACCAC
TGGACCAATCGGCCCATCGCCCTGTCGCCGCCTAACAACCGAACCTTTGTATGGTCCGGGAGCGCCGTCGTCGAC
GTCAACAACACGTCGGGCTTCTTCCCGGACAGGAAAGACGGCGTCATCGCCATATACGTAAGAGTTGACGGTCTA
CTAGTCTCGGCTTTGTTCTCCCATGATGCTAACCGTCTACATATACTAAAAGACGCTCGCCAGCTCAGACCGCCA
GTCTCAGGCCATCTCCTACTCCCACGATGGCGGCTACACCTTCACCCCCTATGACGGAAACCCCGTCATCCCCGG
CGGCAACTCGTCGCAGTTTCGTGACCCTAAAGTCATCTGGCATGACGGCCGCTGGGTCATGACCGTCTCCTACCC
CGTCGACTTCGCCGTTGGCATCTTCACCTCACACAATCTCGTAGACTGGGACCCCGTAAGCAACTTTTCCCTCCA
CGGCCTGCTCGGCCTTCAGTGGGAGTGCCCCAACCTTGTCCGCGTGCCGTACGTGGACCATGATACGGGCGCCCG
CCTCGACGACATGTGGCTCATGGTCGTCTCCGTAAACCCCGGCAGTCCGCTCGGAGGATCCGTCACTCAGTACTT
CCCGGGCACCTTTAACGGCACCCATTTTGAGGCCGTTGACTCGGCTGTGCGCTTCGCCGACTTCGCCAAGGACTA
TTACGCCGGCCAGTTTTACTACGGCCTACCCGACCGAGAGGCCGTCTTCATCGCATGGGCCTCCAATTGGCAGTA
CGCCGAAGCCGTGCCCACAGCTCAAGAAGGCTGGAGATCCGCCATGAGCCTCCCGCGTCGCACCGCCCTGACCAA
GGTCCCCCGCCTCGGATGGAAGCTCGTCTCTCAGCCGTACGACCTGAGCCCCGTCCTAGGCCAAGACCTCGTCTC
CCAGACCGGGCTCACCAACCATTCCCTGGCCCTCGACTTTGCCCACGTCCCGTCCAACGCCTTGTACTGGGAGGC
CAACGTCACGGGTCTGCCTCCCACCAGTGCGCTATCGGCCGCCGCAAGCCTCAACTTCACCTTTGCCAGCAGCCA
CAGCGGCGAGCGCCTCTCGAGCGGATACCATTTGGCGACTGAAGCCTTTTTCCTCGATAGGGGCCAGCTCCGTGG
CTTCCAGAGCCCATTCTTCACCGACAAGTTCTCCCTTGACGCGCCGCCGCGTTCGGGCAGCTCGTGGAGCATCAC
CGGCGTCTTCGACCGCTCCTTGGTCGAGGTCTTCCTCGACAGAGGCGTCGACAGCGCCACGACCATCTTCTTCGC
ACAACAGCCCCTGACCACCATGGTGATTGCCTCGTCGGGGCTCCCGGACGAGGCACGCGTCAGCGTCCGCGTCAA
GGCCCTTCGGAGCGTCTGGAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail