Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3038
Gene name
Locationscaffold_241:363..2222
Strand-
Gene length (bp)1859
Transcript length (bp)1689
Coding sequence length (bp)1686
Protein length (aa) 562

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01644 Chitin_synth_1 Chitin synthase 8.8E-78 302 464
PF08407 Chitin_synth_1N Chitin synthase N-terminal 1.9E-27 230 301
PF03142 Chitin_synth_2 Chitin synthase 6.1E-11 442 537

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92444|CHS2_PARBR Chitin synthase 2 OS=Paracoccidioides brasiliensis GN=CHS2 PE=3 SV=2 82 553 0.0E+00
sp|P30589|CHS2_NEUCR Chitin synthase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-2 PE=3 SV=4 64 556 0.0E+00
sp|P30584|CHSA_EMENI Chitin synthase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsA PE=3 SV=2 81 553 0.0E+00
sp|P30600|CHS1_EXODE Chitin synthase 1 OS=Exophiala dermatitidis GN=CHS1 PE=3 SV=2 245 553 8.0E-177
sp|P87073|CHS1_PHYB8 Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=chs1 PE=3 SV=1 209 553 4.0E-159
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92444|CHS2_PARBR Chitin synthase 2 OS=Paracoccidioides brasiliensis GN=CHS2 PE=3 SV=2 82 553 0.0E+00
sp|P30589|CHS2_NEUCR Chitin synthase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-2 PE=3 SV=4 64 556 0.0E+00
sp|P30584|CHSA_EMENI Chitin synthase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsA PE=3 SV=2 81 553 0.0E+00
sp|P30600|CHS1_EXODE Chitin synthase 1 OS=Exophiala dermatitidis GN=CHS1 PE=3 SV=2 245 553 8.0E-177
sp|P87073|CHS1_PHYB8 Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=chs1 PE=3 SV=1 209 553 4.0E-159
sp|P30595|CHS2_RHIOL Chitin synthase 2 OS=Rhizopus oligosporus GN=CHS2 PE=3 SV=1 208 553 6.0E-159
sp|Q99126|CHS3_USTMA Chitin synthase 3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS3 PE=3 SV=2 207 553 3.0E-158
sp|Q99127|CHS4_USTMA Chitin synthase 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS4 PE=3 SV=2 228 553 1.0E-157
sp|P30594|CHS1_RHIOL Chitin synthase 1 OS=Rhizopus oligosporus GN=CHS1 PE=3 SV=1 210 553 2.0E-156
sp|Q12632|CHS1_MUCCL Chitin synthase 1 OS=Mucor circinelloides f. lusitanicus GN=CHS1 PE=3 SV=1 194 561 4.0E-152
sp|P30597|CHS1_SCHPO Chitin synthase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chs1 PE=3 SV=2 228 549 1.0E-151
sp|P30588|CHS3_NEUCR Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-3 PE=3 SV=2 230 557 2.0E-139
sp|P23316|CHS1_CANAX Chitin synthase 1 OS=Candida albicans GN=CHS1 PE=2 SV=2 223 558 1.0E-135
sp|P30601|CHS2_EXODE Chitin synthase 2 OS=Exophiala dermatitidis GN=CHS2 PE=3 SV=2 203 556 2.0E-135
sp|P30583|CHSC_EMENI Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsC PE=3 SV=3 195 557 4.0E-135
sp|Q12564|CHSA_AMPQU Chitin synthase A OS=Ampelomyces quisqualis GN=CHSA PE=3 SV=1 230 557 3.0E-134
sp|P14180|CHS2_YEAST Chitin synthase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS2 PE=1 SV=1 188 553 2.0E-125
sp|P30572|CHS2_CANAX Chitin synthase 2 OS=Candida albicans GN=CHS2 PE=2 SV=2 219 553 2.0E-106
sp|P30599|CHS2_USTMA Chitin synthase 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS2 PE=3 SV=2 230 558 3.0E-106
sp|P30578|CHS3_AJECA Chitin synthase 3 (Fragment) OS=Ajellomyces capsulatus GN=CHS3 PE=3 SV=1 307 495 3.0E-104
sp|P30591|CHS2_EXOEX Chitin synthase 2 (Fragment) OS=Exophiala exophialae GN=CHS2 PE=3 SV=2 307 495 8.0E-104
sp|P30586|CHS2_EXOJE Chitin synthase 2 (Fragment) OS=Exophiala jeanselmei GN=CHS2 PE=3 SV=2 307 494 1.0E-103
sp|P30580|CHS2_AJEDE Chitin synthase 2 (Fragment) OS=Ajellomyces dermatitidis GN=CHS2 PE=3 SV=1 307 495 2.0E-103
sp|P30602|CHS3_EXODE Chitin synthase 3 OS=Exophiala dermatitidis GN=CHS3 PE=3 SV=2 228 559 7.0E-103
sp|Q92197|CHSC_ASPFU Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsC PE=3 SV=2 195 549 3.0E-102
sp|P30582|CHS2_ASPNG Chitin synthase 2 (Fragment) OS=Aspergillus niger GN=chs2 PE=3 SV=1 307 495 3.0E-102
sp|P30598|CHS1_USTMA Chitin synthase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS1 PE=3 SV=3 210 558 9.0E-102
sp|P55003|CHS1_TUBUN Chitin synthase 1 (Fragment) OS=Tuber uncinatum GN=CHS1 PE=3 SV=1 307 495 7.0E-101
sp|P54267|CHSG_ASPFU Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsG PE=2 SV=2 228 549 2.0E-99
sp|Q00757|CHSB_EMENI Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsB PE=2 SV=2 228 549 3.0E-99
sp|P29070|CHS1_NEUCR Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-1 PE=3 SV=2 212 559 5.0E-99
sp|P30604|CHS2_XYLBA Chitin synthase 2 (Fragment) OS=Xylohypha bantiana GN=CHS2 PE=3 SV=1 307 495 9.0E-96
sp|P08004|CHS1_YEAST Chitin synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS1 PE=1 SV=2 220 555 2.0E-95
sp|P30596|CHS1_SCHCO Chitin synthase 1 (Fragment) OS=Schizophyllum commune GN=CHS1 PE=3 SV=1 310 495 6.0E-93
sp|P49603|CHS1_BOTFU Chitin synthase 1 (Fragment) OS=Botryotinia fuckeliana GN=chs1 PE=3 SV=1 307 495 1.0E-78
sp|O74756|CHS2_SCHPO Chitin synthase-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chs2 PE=3 SV=1 230 549 1.0E-74
sp|P30576|CHS1_AJECA Chitin synthase 1 (Fragment) OS=Ajellomyces capsulatus GN=CHS1 PE=3 SV=1 307 495 3.0E-74
sp|P30581|CHS1_ASPNG Chitin synthase 1 (Fragment) OS=Aspergillus niger GN=chs1 PE=3 SV=1 310 494 5.0E-74
sp|P30579|CHS1_AJEDE Chitin synthase 1 (Fragment) OS=Ajellomyces dermatitidis GN=CHS1 PE=3 SV=1 310 495 1.0E-73
sp|P30585|CHS1_EXOJE Chitin synthase 1 (Fragment) OS=Exophiala jeanselmei GN=CHS1 PE=3 SV=1 307 495 8.0E-73
sp|P30590|CHS1_EXOEX Chitin synthase 1 (Fragment) OS=Exophiala exophialae GN=CHS1 PE=3 SV=1 307 495 4.0E-72
sp|P30592|CHS1_RHIAT Chitin synthase 1 (Fragment) OS=Rhinocladiella atrovirens GN=CHS1 PE=3 SV=1 307 495 8.0E-72
sp|P30603|CHS1_XYLBA Chitin synthase 1 (Fragment) OS=Xylohypha bantiana GN=CHS1 PE=3 SV=1 307 495 1.0E-71
sp|P30577|CHS2_AJECA Chitin synthase 2 (Fragment) OS=Ajellomyces capsulatus GN=CHS2 PE=3 SV=1 311 494 2.0E-58
sp|P30593|CHS2_RHIAT Chitin synthase 2 (Fragment) OS=Rhinocladiella atrovirens GN=CHS2 PE=3 SV=1 307 495 4.0E-57
sp|P48017|CHS_SAPMO Chitin synthase OS=Saprolegnia monoica GN=CHS PE=3 SV=1 260 550 1.0E-55
sp|P30587|CHS3_EXOJE Chitin synthase 3 (Fragment) OS=Exophiala jeanselmei GN=CHS3 PE=3 SV=1 329 495 4.0E-51
sp|Q01285|CHS4_NEUCR Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-4 PE=3 SV=3 273 531 6.0E-08
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 362 531 8.0E-08
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 442 531 5.0E-07
sp|O13356|CHS1_CRYNH Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS1 PE=3 SV=2 444 542 6.0E-07
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 341 528 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004100 chitin synthase activity Yes
GO:0006031 chitin biosynthetic process Yes
GO:0016740 transferase activity No
GO:0008375 acetylglucosaminyltransferase activity No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0006023 aminoglycan biosynthetic process No
GO:1901071 glucosamine-containing compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0006040 amino sugar metabolic process No
GO:0016758 hexosyltransferase activity No
GO:0009058 biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0046349 amino sugar biosynthetic process No
GO:1901073 glucosamine-containing compound biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0008194 UDP-glycosyltransferase activity No
GO:1901135 carbohydrate derivative metabolic process No
GO:0016757 glycosyltransferase activity No
GO:0006022 aminoglycan metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0006030 chitin metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3038
MHRPKTPPDYGLPSYGEGEGYGYDDGRETPSAGVRLLGEPPERPSSVASSTARRLYQPTPSFSMPPPDSTYVPFA
GRDGGGSPHRSWTAASDIGSARQQQPPPPPSVSFEPPDLNGGRRPGTPSSRYGGSPRRPLPPAPLFSSVSARSSE
DDDAAVTIPLDGVGVDEDDDPFAPKETNKLHRGLYASLSQETLNENEEPALQDDKIEHYGPAPNGAQERRGVRAP
QMSRKEVQLINGELVLECKIPTILHSFLPRRSEVEFTHMRYTAVTCDPDDFVSRGYKLRQSMGRTTRETELFICV
TMYNEDEICFTRTMHAVMKNIAHFCSRSRSRTWGEAGWQKIVVCIISDGRDKINPRTLDALAAMGVYQHGIAKNY
VNNRAVQAHVYEYTTQVSMDADLRFKGAEKGIVPCQIIFCLKEKNQRKLNSHRWFFNAFGKALNPNVCILLDVGT
RPGSNSLYHLWKAFDTDSNVAGACGEIKAMKGKLGSNLLNPLVASQNFEYKMSNILDKPLESVFGYITVLPGALS
AYRYHALQNDETGHGPLSQYFKGETLHGVHGGDGRSR
Coding >Ophio5|3038
ATGCACAGGCCAAAGACGCCGCCGGACTATGGCCTGCCCAGCTACGGCGAAGGCGAAGGCTACGGCTACGACGAC
GGCCGCGAGACGCCCAGTGCCGGCGTGAGATTGCTGGGAGAGCCGCCTGAGCGCCCGTCGTCTGTAGCCTCCTCA
ACCGCCAGACGGCTCTATCAACCGACGCCCTCGTTTAGTATGCCGCCGCCCGACTCGACATACGTGCCCTTTGCC
GGCCGTGATGGGGGCGGCTCGCCTCATCGGTCCTGGACAGCGGCGTCGGATATCGGATCAGCTAGGCAACAGCAG
CCGCCGCCGCCGCCAAGCGTGTCGTTTGAGCCGCCAGACCTCAACGGCGGCCGGCGGCCGGGGACGCCGTCTTCG
AGGTACGGCGGCAGTCCGAGACGGCCTCTCCCTCCGGCGCCGCTGTTCTCGTCCGTCTCGGCGCGCAGCTCGGAG
GATGACGATGCTGCCGTCACGATTCCCCTGGACGGGGTCGGAGTCGACGAGGACGACGACCCGTTCGCGCCCAAG
GAGACGAACAAGCTCCATCGCGGCTTGTACGCCTCTCTGTCGCAGGAGACGCTCAACGAGAACGAGGAGCCGGCT
CTGCAGGACGACAAGATCGAACATTACGGCCCAGCACCCAACGGCGCACAGGAGCGTCGCGGCGTCCGAGCACCG
CAGATGTCACGGAAAGAAGTGCAACTCATCAACGGCGAACTCGTCCTCGAGTGCAAGATCCCCACCATCCTTCAC
AGCTTCCTCCCGCGACGCAGCGAGGTCGAGTTTACACACATGCGTTACACGGCCGTCACCTGCGATCCCGACGAC
TTCGTCAGTCGCGGGTACAAGCTGCGGCAGAGCATGGGACGGACGACGCGCGAGACGGAGCTGTTCATCTGCGTC
ACCATGTACAACGAGGACGAGATTTGCTTCACGCGGACGATGCATGCGGTGATGAAGAACATTGCCCATTTCTGC
TCTCGTTCCAGGTCTCGCACCTGGGGCGAGGCGGGATGGCAGAAGATTGTCGTCTGCATCATCTCGGACGGACGA
GACAAGATCAACCCGCGTACGCTCGATGCTCTGGCGGCCATGGGCGTCTATCAGCATGGCATCGCCAAGAACTAC
GTCAACAACCGGGCTGTACAGGCTCACGTGTACGAATACACGACGCAGGTGTCCATGGACGCCGACCTGCGCTTC
AAAGGCGCGGAAAAGGGCATCGTGCCTTGTCAGATCATCTTCTGCCTCAAGGAGAAGAACCAGCGGAAGCTGAAT
TCGCACCGTTGGTTCTTCAACGCCTTCGGCAAGGCGCTGAACCCCAACGTCTGCATCCTGCTCGACGTCGGCACC
CGGCCGGGCAGCAACTCGCTCTACCACCTGTGGAAGGCCTTTGACACCGACTCCAACGTGGCCGGCGCCTGTGGC
GAGATCAAGGCGATGAAGGGCAAGCTGGGCTCCAACCTGCTGAACCCGCTGGTGGCGTCGCAGAACTTCGAGTAC
AAGATGAGCAACATCCTGGACAAGCCGCTCGAGTCCGTCTTCGGCTACATCACGGTGCTGCCGGGGGCGCTGAGC
GCCTACCGGTACCACGCGCTGCAGAACGACGAGACGGGTCACGGGCCGCTGAGCCAGTATTTCAAGGGCGAGACG
CTCCACGGGGTGCACGGGGGAGACGGACGTTCCCGG
Transcript >Ophio5|3038
ATGCACAGGCCAAAGACGCCGCCGGACTATGGCCTGCCCAGCTACGGCGAAGGCGAAGGCTACGGCTACGACGAC
GGCCGCGAGACGCCCAGTGCCGGCGTGAGATTGCTGGGAGAGCCGCCTGAGCGCCCGTCGTCTGTAGCCTCCTCA
ACCGCCAGACGGCTCTATCAACCGACGCCCTCGTTTAGTATGCCGCCGCCCGACTCGACATACGTGCCCTTTGCC
GGCCGTGATGGGGGCGGCTCGCCTCATCGGTCCTGGACAGCGGCGTCGGATATCGGATCAGCTAGGCAACAGCAG
CCGCCGCCGCCGCCAAGCGTGTCGTTTGAGCCGCCAGACCTCAACGGCGGCCGGCGGCCGGGGACGCCGTCTTCG
AGGTACGGCGGCAGTCCGAGACGGCCTCTCCCTCCGGCGCCGCTGTTCTCGTCCGTCTCGGCGCGCAGCTCGGAG
GATGACGATGCTGCCGTCACGATTCCCCTGGACGGGGTCGGAGTCGACGAGGACGACGACCCGTTCGCGCCCAAG
GAGACGAACAAGCTCCATCGCGGCTTGTACGCCTCTCTGTCGCAGGAGACGCTCAACGAGAACGAGGAGCCGGCT
CTGCAGGACGACAAGATCGAACATTACGGCCCAGCACCCAACGGCGCACAGGAGCGTCGCGGCGTCCGAGCACCG
CAGATGTCACGGAAAGAAGTGCAACTCATCAACGGCGAACTCGTCCTCGAGTGCAAGATCCCCACCATCCTTCAC
AGCTTCCTCCCGCGACGCAGCGAGGTCGAGTTTACACACATGCGTTACACGGCCGTCACCTGCGATCCCGACGAC
TTCGTCAGTCGCGGGTACAAGCTGCGGCAGAGCATGGGACGGACGACGCGCGAGACGGAGCTGTTCATCTGCGTC
ACCATGTACAACGAGGACGAGATTTGCTTCACGCGGACGATGCATGCGGTGATGAAGAACATTGCCCATTTCTGC
TCTCGTTCCAGGTCTCGCACCTGGGGCGAGGCGGGATGGCAGAAGATTGTCGTCTGCATCATCTCGGACGGACGA
GACAAGATCAACCCGCGTACGCTCGATGCTCTGGCGGCCATGGGCGTCTATCAGCATGGCATCGCCAAGAACTAC
GTCAACAACCGGGCTGTACAGGCTCACGTGTACGAATACACGACGCAGGTGTCCATGGACGCCGACCTGCGCTTC
AAAGGCGCGGAAAAGGGCATCGTGCCTTGTCAGATCATCTTCTGCCTCAAGGAGAAGAACCAGCGGAAGCTGAAT
TCGCACCGTTGGTTCTTCAACGCCTTCGGCAAGGCGCTGAACCCCAACGTCTGCATCCTGCTCGACGTCGGCACC
CGGCCGGGCAGCAACTCGCTCTACCACCTGTGGAAGGCCTTTGACACCGACTCCAACGTGGCCGGCGCCTGTGGC
GAGATCAAGGCGATGAAGGGCAAGCTGGGCTCCAACCTGCTGAACCCGCTGGTGGCGTCGCAGAACTTCGAGTAC
AAGATGAGCAACATCCTGGACAAGCCGCTCGAGTCCGTCTTCGGCTACATCACGGTGCTGCCGGGGGCGCTGAGC
GCCTACCGGTACCACGCGCTGCAGAACGACGAGACGGGTCACGGGCCGCTGAGCCAGTATTTCAAGGGCGAGACG
CTCCACGGGGTGCACGGGGGAGACGGACGTTCCCGGTGA
Gene >Ophio5|3038
ATGCACAGGCCAAAGACGCCGCCGGACTATGGCCTGCCCAGCTACGGCGAAGGCGAAGGCTACGGCTACGACGAC
GGCCGCGAGACGCCCAGTGCCGGCGTGAGATTGCTGGGAGAGCCGCCTGAGCGCCCGTCGTCTGTAGCGTACGTT
GCCCGTGGGGGTCTGACAGGGAAGAAGCATCTAACGTCTTGTCGTCTGTCCAGCTCCTCAACCGCCAGACGGCTC
TATCAACCGACGCCCTCGTTTAGTATGCCGCCGCCCGACTCGACATACGTGCCCTTTGCCGGCCGTGATGGGGGC
GGCTCGCCTCATCGGTCCTGGACAGCGGCGTCGGATATCGGATCAGCTAGGCAACAGCAGCCGCCGCCGCCGCCA
AGCGTGTCGTTTGAGCCGCCAGACCTCAACGGCGGCCGGCGGCCGGGGACGCCGTCTTCGAGGTACGGCGGCAGT
CCGAGACGGCCTCTCCCTCCGGCGCCGCTGTTCTCGTCCGTCTCGGCGCGCAGCTCGGAGGATGACGATGCTGCC
GTCACGATTCCCCTGGACGGGGTCGGAGTCGACGAGGACGACGACCCGTTCGCGCCCAAGGAGACGAACAAGCTC
CATCGCGGCTTGTACGCCTCTCTGTCGCAGGAGACGCTCAACGAGAACGAGGAGCCGGCTCTGCAGGACGACAAG
ATCGAACATTACGGCCCAGCACCCAACGGCGCACAGGAGCGTCGCGGCGTCCGAGCACCGCAGATGTCACGGAAA
GAAGTGCAACTCATCAACGGCGAACTCGTCCTCGAGTGCAAGATCCCCACCATCCTTCACAGCTTCCTCCCGCGA
CGCAGCGAGGTCGAGTTTACACACATGCGTTACACGGCCGTCACCTGCGATCCCGACGACTTCGTCAGTCGCGGG
TACAAGCTGCGGCAGAGCATGGGACGGACGACGCGCGAGACGGAGCTGTTCATCTGCGTCACCATGTACAACGAG
GACGAGATTTGCTTCACGCGGACGATGCATGCGGTGATGAAGAACATTGCCCATTTCTGCTCTCGTTCCAGGTCT
CGCACCTGGGGCGAGGCGGGATGGCAGAAGATTGTCGTCTGCATCATCTCGGACGGACGAGACAAGATCAACCCG
CGTACGCTCGATGCTCTGGCGGCCATGGGCGTCTATCAGCATGGCATCGCCAAGAACTACGTCAACAACCGGGCT
GTACAGGCTCACGTGTACGAATACACGACGCAGGTGTCCATGGACGCCGACCTGCGCTTCAAAGGCGCGGAAAAG
GGCATCGTGCCTTGTCAGATCATCTTCTGCCTCAAGGAGAAGAACCAGCGGAAGCTGAATTCGCACCGTTGGTTC
TTCAACGCCTTCGGCAAGGCGCTGAACCCCAACGTCTGCATCCTGCTCGACGTCGGCACCCGGCCGGGCAGCAAC
TCGCTCTACCACCTGTGGAAGGCCTTTGACACCGACTCCAACGTGGCCGGCGCCTGTGGCGAGATCAAGGCGATG
AAGGGCAAGCTGGGCTCCAACCTGCTGAACCCGCTGGTGGCGTCGCAGAACTTCGAGTACAAGATGAGCAACATC
CTGGACAAGCCGCTCGAGTCCGTCTTCGGCTACATCACGGTGCTGCCGGGGGCGCTGAGCGCCTACCGGTACCAC
GCGCTGCAGAACGACGAGACGGGTCACGGGCCGCTGAGCCAGTATTTCAAGGGCGAGACGCTCCACGGTCAGCGG
GCCGATGTCTTCACCGCCAACATGTATCTGGCCGAGGACCGCATCTTGTGCTGGGAGTTGGTGGCCAAGAGGGGG
GAGCGCTGGGTGCTCAAGTATGTCAAGGGGTGCACGGGGGAGACGGACGTTCCCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail