Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3037
Gene name
Locationscaffold_240:27278..28106
Strand-
Gene length (bp)828
Transcript length (bp)738
Coding sequence length (bp)735
Protein length (aa) 245

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00005 ABC_tran ABC transporter 1.2E-05 141 234

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 110 236 2.0E-19
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 128 243 6.0E-19
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 125 236 1.0E-18
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 125 236 2.0E-18
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 128 243 6.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 110 236 2.0E-19
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 128 243 6.0E-19
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 125 236 1.0E-18
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 125 236 2.0E-18
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 128 243 6.0E-18
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 125 236 2.0E-17
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 125 236 2.0E-17
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 125 236 8.0E-17
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 125 236 8.0E-17
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 147 236 9.0E-17
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 127 243 1.0E-16
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 125 236 2.0E-16
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 145 236 3.0E-16
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 145 236 6.0E-16
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 125 236 8.0E-16
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 145 236 1.0E-15
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 145 236 1.0E-15
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 128 236 1.0E-15
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 127 243 2.0E-15
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 128 236 3.0E-15
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 145 236 3.0E-15
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 126 236 2.0E-14
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 145 236 3.0E-14
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 147 236 3.0E-14
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 147 236 1.0E-13
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 145 236 1.0E-13
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 147 236 1.0E-12
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 147 236 2.0E-12
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 147 236 4.0E-12
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 147 236 9.0E-12
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 145 236 1.0E-11
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 147 236 1.0E-11
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 149 236 4.0E-11
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 147 236 6.0E-11
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 129 236 2.0E-10
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 129 236 2.0E-10
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 147 236 2.0E-10
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 147 236 3.0E-10
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 147 236 4.0E-10
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 147 236 4.0E-10
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 127 236 6.0E-10
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 122 234 1.0E-09
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 129 236 1.0E-09
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 129 236 2.0E-09
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 145 236 2.0E-09
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 127 236 4.0E-09
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 104 236 4.0E-09
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 147 236 1.0E-08
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 147 236 1.0E-08
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 125 236 3.0E-08
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 145 236 4.0E-08
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 128 236 9.0E-08
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 147 236 1.0E-07
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 128 236 3.0E-07
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 147 236 5.0E-07
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 147 236 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 1.76 0.00 3.64
CcL In ants, during behavior modification 3.31 0.09 6.52
CcD In ants, recently dead 2.38 0.00 4.76

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.243994 no
SC16a CcD 0.601632 no
CcL CcD 0.544904 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3037
MPRIDSLVHYTSQSCYLLTLYLDIVCNSQNAANGLRLLKAIYTMTATWGNKVARNRRQATGENSFEERSAASYKP
TGHLANRRPPLPDHDSISLNDVAPVYVQIRKLSVSINHKLSTPPSRPAWSQAGTATLNGQLGVQTYDMPMMQQDI
LLLTLTARMTLQYAAEMPLPPSTPTCACQRVIGGVIRELGLKDCAEACVGSSQHRGCSGGDKRRVSIVVPLPATP
SVLFLDEPSTASILAAPFSL
Coding >Ophio5|3037
ATGCCACGCATCGATTCTTTGGTTCACTACACATCCCAATCTTGTTATCTTCTTACTCTATACCTTGATATTGTA
TGCAACTCACAAAACGCCGCCAACGGACTTCGGCTGCTCAAGGCGATTTATACTATGACTGCCACGTGGGGCAAC
AAAGTCGCCCGCAATCGACGTCAGGCAACCGGCGAAAATTCCTTCGAGGAAAGATCAGCCGCCTCTTACAAGCCC
ACTGGTCACTTAGCGAATCGTCGACCACCGCTTCCTGATCATGACAGCATTTCCCTCAACGACGTCGCTCCTGTC
TACGTACAGATCCGCAAGCTCTCGGTATCCATTAACCACAAACTGTCAACACCTCCCTCCCGGCCAGCATGGAGC
CAGGCGGGCACGGCAACATTAAACGGCCAGCTTGGCGTGCAAACGTACGATATGCCTATGATGCAGCAGGATATC
CTCCTGCTGACCTTGACTGCCCGAATGACTCTACAGTACGCGGCGGAGATGCCACTGCCGCCTAGCACGCCGACC
TGCGCTTGCCAGAGGGTCATTGGAGGAGTCATTCGTGAGCTTGGTCTCAAGGACTGCGCCGAGGCGTGCGTTGGC
AGTAGCCAGCATCGGGGTTGCTCCGGTGGCGACAAGAGGCGTGTGAGCATCGTAGTGCCGCTGCCCGCCACCCCG
TCTGTTCTCTTCCTCGACGAGCCGAGCACGGCTTCGATTCTAGCAGCGCCCTTCAGCTTG
Transcript >Ophio5|3037
ATGCCACGCATCGATTCTTTGGTTCACTACACATCCCAATCTTGTTATCTTCTTACTCTATACCTTGATATTGTA
TGCAACTCACAAAACGCCGCCAACGGACTTCGGCTGCTCAAGGCGATTTATACTATGACTGCCACGTGGGGCAAC
AAAGTCGCCCGCAATCGACGTCAGGCAACCGGCGAAAATTCCTTCGAGGAAAGATCAGCCGCCTCTTACAAGCCC
ACTGGTCACTTAGCGAATCGTCGACCACCGCTTCCTGATCATGACAGCATTTCCCTCAACGACGTCGCTCCTGTC
TACGTACAGATCCGCAAGCTCTCGGTATCCATTAACCACAAACTGTCAACACCTCCCTCCCGGCCAGCATGGAGC
CAGGCGGGCACGGCAACATTAAACGGCCAGCTTGGCGTGCAAACGTACGATATGCCTATGATGCAGCAGGATATC
CTCCTGCTGACCTTGACTGCCCGAATGACTCTACAGTACGCGGCGGAGATGCCACTGCCGCCTAGCACGCCGACC
TGCGCTTGCCAGAGGGTCATTGGAGGAGTCATTCGTGAGCTTGGTCTCAAGGACTGCGCCGAGGCGTGCGTTGGC
AGTAGCCAGCATCGGGGTTGCTCCGGTGGCGACAAGAGGCGTGTGAGCATCGTAGTGCCGCTGCCCGCCACCCCG
TCTGTTCTCTTCCTCGACGAGCCGAGCACGGCTTCGATTCTAGCAGCGCCCTTCAGCTTGTAA
Gene >Ophio5|3037
ATGCCACGCATCGATTCTTTGGTTCACTACACATCCCAATCTTGTTATCTTCTTACTCTATACCTTGATATTGTA
TGCAACTCACAAAACGCCGCCAACGGACTTCGGCTGCTCAAGGCGATTTATACTATGACTGCCACGTGGGGCAAC
AAAGTCGCCCGCAATCGACGTCAGGCAACCGGCGAAAATTCCTTCGAGGAAAGATCAGCCGCCTCTTACAAGCCC
ACTGGTCACTTAGCGAATCGTCGACCACCGCTTCCTGATCATGACAGCATTTCCCTCAACGACGTCGCTCCTGTC
TACGTACAGATCCGCAAGCTCTCGGTATCCATTAACCACAAACTGTCAACGTATCGAGGCCGTTTAGCCACAAGG
CTATTCGGGAAGCAAAGTGCCGCAACCCCTTGACAACGACGCTGCTGCTGCACTAGTGGCGGCAGACCTCCCTCC
CGGCCAGCATGGAGCCAGGCGGGCACGGCAACATTAAACGGCCAGCTTGGCGTGCAAACGTACGATATGCCTATG
ATGCAGCAGGATATCCTCCTGCTGACCTTGACTGCCCGAATGACTCTACAGTACGCGGCGGAGATGCCACTGCCG
CCTAGCACGCCGACCTGCGCTTGCCAGAGGGTCATTGGAGGAGTCATTCGTGAGCTTGGTCTCAAGGACTGCGCC
GAGGCGTGCGTTGGCAGTAGCCAGCATCGGGGTTGCTCCGGTGGCGACAAGAGGCGTGTGAGCATCGTAGTGCCG
CTGCCCGCCACCCCGTCTGTTCTCTTCCTCGACGAGCCGAGCACGGCTTCGATTCTAGCAGCGCCCTTCAGCTTG
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail