Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3037
Gene name
Locationscaffold_240:27278..28106
Strand-
Gene length (bp)828
Transcript length (bp)738
Coding sequence length (bp)735
Protein length (aa) 245

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00005 ABC_tran ABC transporter 1.2E-05 141 234

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 110 236 2.0E-19
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 128 243 6.0E-19
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 125 236 1.0E-18
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 125 236 2.0E-18
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 128 243 6.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 110 236 2.0E-19
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 128 243 6.0E-19
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 125 236 1.0E-18
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 125 236 2.0E-18
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 128 243 6.0E-18
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 125 236 2.0E-17
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 125 236 2.0E-17
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 125 236 8.0E-17
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 125 236 8.0E-17
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 147 236 9.0E-17
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 127 243 1.0E-16
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 125 236 2.0E-16
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 145 236 3.0E-16
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 145 236 6.0E-16
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 125 236 8.0E-16
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 145 236 1.0E-15
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 145 236 1.0E-15
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 128 236 1.0E-15
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 127 243 2.0E-15
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 128 236 3.0E-15
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 145 236 3.0E-15
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 126 236 2.0E-14
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 145 236 3.0E-14
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 147 236 3.0E-14
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 147 236 1.0E-13
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 145 236 1.0E-13
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 147 236 1.0E-12
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 147 236 2.0E-12
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 147 236 4.0E-12
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 147 236 9.0E-12
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 145 236 1.0E-11
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 147 236 1.0E-11
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 149 236 4.0E-11
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 147 236 6.0E-11
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 129 236 2.0E-10
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 129 236 2.0E-10
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 147 236 2.0E-10
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 147 236 3.0E-10
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 147 236 4.0E-10
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 147 236 4.0E-10
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 127 236 6.0E-10
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 122 234 1.0E-09
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 129 236 1.0E-09
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 129 236 2.0E-09
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 145 236 2.0E-09
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 127 236 4.0E-09
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 104 236 4.0E-09
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 147 236 1.0E-08
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 147 236 1.0E-08
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 125 236 3.0E-08
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 145 236 4.0E-08
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 128 236 9.0E-08
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 147 236 1.0E-07
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 128 236 3.0E-07
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 147 236 5.0E-07
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 147 236 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3037
MPRIDSLVHYTSQSCYLLTLYLDIVCNSQNAANGLRLLKAIYTMTATWGNKVARNRRQATGENSFEERSAASYKP
TGHLANRRPPLPDHDSISLNDVAPVYVQIRKLSVSINHKLSTPPSRPAWSQAGTATLNGQLGVQTYDMPMMQQDI
LLLTLTARMTLQYAAEMPLPPSTPTCACQRVIGGVIRELGLKDCAEACVGSSQHRGCSGGDKRRVSIVVPLPATP
SVLFLDEPSTASILAAPFSL
Coding >Ophio5|3037
ATGCCACGCATCGATTCTTTGGTTCACTACACATCCCAATCTTGTTATCTTCTTACTCTATACCTTGATATTGTA
TGCAACTCACAAAACGCCGCCAACGGACTTCGGCTGCTCAAGGCGATTTATACTATGACTGCCACGTGGGGCAAC
AAAGTCGCCCGCAATCGACGTCAGGCAACCGGCGAAAATTCCTTCGAGGAAAGATCAGCCGCCTCTTACAAGCCC
ACTGGTCACTTAGCGAATCGTCGACCACCGCTTCCTGATCATGACAGCATTTCCCTCAACGACGTCGCTCCTGTC
TACGTACAGATCCGCAAGCTCTCGGTATCCATTAACCACAAACTGTCAACACCTCCCTCCCGGCCAGCATGGAGC
CAGGCGGGCACGGCAACATTAAACGGCCAGCTTGGCGTGCAAACGTACGATATGCCTATGATGCAGCAGGATATC
CTCCTGCTGACCTTGACTGCCCGAATGACTCTACAGTACGCGGCGGAGATGCCACTGCCGCCTAGCACGCCGACC
TGCGCTTGCCAGAGGGTCATTGGAGGAGTCATTCGTGAGCTTGGTCTCAAGGACTGCGCCGAGGCGTGCGTTGGC
AGTAGCCAGCATCGGGGTTGCTCCGGTGGCGACAAGAGGCGTGTGAGCATCGTAGTGCCGCTGCCCGCCACCCCG
TCTGTTCTCTTCCTCGACGAGCCGAGCACGGCTTCGATTCTAGCAGCGCCCTTCAGCTTG
Transcript >Ophio5|3037
ATGCCACGCATCGATTCTTTGGTTCACTACACATCCCAATCTTGTTATCTTCTTACTCTATACCTTGATATTGTA
TGCAACTCACAAAACGCCGCCAACGGACTTCGGCTGCTCAAGGCGATTTATACTATGACTGCCACGTGGGGCAAC
AAAGTCGCCCGCAATCGACGTCAGGCAACCGGCGAAAATTCCTTCGAGGAAAGATCAGCCGCCTCTTACAAGCCC
ACTGGTCACTTAGCGAATCGTCGACCACCGCTTCCTGATCATGACAGCATTTCCCTCAACGACGTCGCTCCTGTC
TACGTACAGATCCGCAAGCTCTCGGTATCCATTAACCACAAACTGTCAACACCTCCCTCCCGGCCAGCATGGAGC
CAGGCGGGCACGGCAACATTAAACGGCCAGCTTGGCGTGCAAACGTACGATATGCCTATGATGCAGCAGGATATC
CTCCTGCTGACCTTGACTGCCCGAATGACTCTACAGTACGCGGCGGAGATGCCACTGCCGCCTAGCACGCCGACC
TGCGCTTGCCAGAGGGTCATTGGAGGAGTCATTCGTGAGCTTGGTCTCAAGGACTGCGCCGAGGCGTGCGTTGGC
AGTAGCCAGCATCGGGGTTGCTCCGGTGGCGACAAGAGGCGTGTGAGCATCGTAGTGCCGCTGCCCGCCACCCCG
TCTGTTCTCTTCCTCGACGAGCCGAGCACGGCTTCGATTCTAGCAGCGCCCTTCAGCTTGTAA
Gene >Ophio5|3037
ATGCCACGCATCGATTCTTTGGTTCACTACACATCCCAATCTTGTTATCTTCTTACTCTATACCTTGATATTGTA
TGCAACTCACAAAACGCCGCCAACGGACTTCGGCTGCTCAAGGCGATTTATACTATGACTGCCACGTGGGGCAAC
AAAGTCGCCCGCAATCGACGTCAGGCAACCGGCGAAAATTCCTTCGAGGAAAGATCAGCCGCCTCTTACAAGCCC
ACTGGTCACTTAGCGAATCGTCGACCACCGCTTCCTGATCATGACAGCATTTCCCTCAACGACGTCGCTCCTGTC
TACGTACAGATCCGCAAGCTCTCGGTATCCATTAACCACAAACTGTCAACGTATCGAGGCCGTTTAGCCACAAGG
CTATTCGGGAAGCAAAGTGCCGCAACCCCTTGACAACGACGCTGCTGCTGCACTAGTGGCGGCAGACCTCCCTCC
CGGCCAGCATGGAGCCAGGCGGGCACGGCAACATTAAACGGCCAGCTTGGCGTGCAAACGTACGATATGCCTATG
ATGCAGCAGGATATCCTCCTGCTGACCTTGACTGCCCGAATGACTCTACAGTACGCGGCGGAGATGCCACTGCCG
CCTAGCACGCCGACCTGCGCTTGCCAGAGGGTCATTGGAGGAGTCATTCGTGAGCTTGGTCTCAAGGACTGCGCC
GAGGCGTGCGTTGGCAGTAGCCAGCATCGGGGTTGCTCCGGTGGCGACAAGAGGCGTGTGAGCATCGTAGTGCCG
CTGCCCGCCACCCCGTCTGTTCTCTTCCTCGACGAGCCGAGCACGGCTTCGATTCTAGCAGCGCCCTTCAGCTTG
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail