Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3035
Gene name
Locationscaffold_240:23006..23740
Strand-
Gene length (bp)734
Transcript length (bp)564
Coding sequence length (bp)561
Protein length (aa) 187

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 7.4E-10 6 148

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 8 140 6.0E-07

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0050660 flavin adenine dinucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3035
MSQNRFKVIIVGGSITGLTLAHSLHQIGVDYIILEKRPRVVLQEGASIGILPNGARILDQLGLYSSIEQTTGSLG
ASDIYFPDGFHFSSPYPTRVLESFGYPISFMERRRLLEILYNALPDKTKIHTKKEVISVEPDAIEEKSSIRSNSG
RNVAHGESVRQSRDDNERTKNYVGRIFMLFWYLRRSC
Coding >Ophio5|3035
ATGTCTCAAAACCGTTTCAAGGTCATTATCGTCGGCGGTTCCATCACGGGCCTCACGCTGGCTCATAGCTTGCAT
CAAATCGGGGTTGATTACATTATCCTGGAGAAGAGACCAAGGGTTGTGCTGCAAGAAGGAGCGTCAATTGGCATA
CTACCTAATGGAGCGCGAATCTTAGATCAACTCGGTCTCTACAGCTCTATCGAGCAAACTACAGGATCCCTTGGG
GCATCGGATATTTACTTTCCCGATGGCTTCCACTTTAGCAGCCCTTATCCGACGAGGGTTTTGGAAAGCTTTGGA
TATCCCATCTCATTCATGGAAAGGAGGAGATTACTCGAGATTCTATACAATGCCCTGCCCGACAAAACGAAAATC
CATACAAAAAAAGAAGTCATTAGCGTCGAACCAGACGCAATTGAAGAGAAAAGTTCTATCCGGTCGAATTCGGGA
CGAAATGTGGCGCATGGCGAGTCTGTCAGGCAGTCCCGAGATGACAACGAGCGGACGAAAAACTATGTCGGCCGA
ATATTCATGCTGTTTTGGTATCTCCGCCGGAGTTGC
Transcript >Ophio5|3035
ATGTCTCAAAACCGTTTCAAGGTCATTATCGTCGGCGGTTCCATCACGGGCCTCACGCTGGCTCATAGCTTGCAT
CAAATCGGGGTTGATTACATTATCCTGGAGAAGAGACCAAGGGTTGTGCTGCAAGAAGGAGCGTCAATTGGCATA
CTACCTAATGGAGCGCGAATCTTAGATCAACTCGGTCTCTACAGCTCTATCGAGCAAACTACAGGATCCCTTGGG
GCATCGGATATTTACTTTCCCGATGGCTTCCACTTTAGCAGCCCTTATCCGACGAGGGTTTTGGAAAGCTTTGGA
TATCCCATCTCATTCATGGAAAGGAGGAGATTACTCGAGATTCTATACAATGCCCTGCCCGACAAAACGAAAATC
CATACAAAAAAAGAAGTCATTAGCGTCGAACCAGACGCAATTGAAGAGAAAAGTTCTATCCGGTCGAATTCGGGA
CGAAATGTGGCGCATGGCGAGTCTGTCAGGCAGTCCCGAGATGACAACGAGCGGACGAAAAACTATGTCGGCCGA
ATATTCATGCTGTTTTGGTATCTCCGCCGGAGTTGCTGA
Gene >Ophio5|3035
ATGTCTCAAAACCGTTTCAAGGTCATTATCGTCGGCGGTTCCATCACGGGCCTCACGCTGGCTCATAGCTTGCAT
CAAATCGGGGTTGATTACATTATCCTGGAGAAGAGACCAAGGGTTGTGCTGCAAGAAGGAGCGTCAATTGGCATA
CTACCTAATGGAGCGCGAATCTTAGATCAACTCGGTCTCTACAGCTCTATCGAGCAAACTACAGGATCCCTTGGG
GCATCGGATATTTACTTTCCCGATGGCTTCCACTTTAGCAGCCCTTATCCGACGAGGGTTTTGGAAAGGTGAGCG
GCAAGAGGCAGAAAACTTTTTATTTGTTAACTTGGGGGGCCTAGCTTTGGATATCCCATCTCATTCATGGAAAGG
AGGAGATTACTCGAGATTCTATACAATGCCCTGCCCGACAAAACGAAAATCCATACAAAAAAAGAAGTCATTAGC
GTCGAACCAGACGCAATTGAAGAGAAAAGTTCTATCCGGGTGCGGACTGTTGACGGAGGCATCTATGAAGGCGAC
CTTGTCGTCGGGGCTGACGGGGTGCATAGTCGAATTCGGGACGAAATGTGGCGCATGGCGAGTCTGTCAGGCAGT
CCCGAGATGACAACGAGCGGACGAAAAAGTAAACTTTTCGCGGCGATATTCTCTGCAGAGCCGGACTAATGCTAT
TTTTCAGCTATGTCGGCCGAATATTCATGCTGTTTTGGTATCTCCGCCGGAGTTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail