Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3030
Gene name
Locationscaffold_240:14249..15441
Strand-
Gene length (bp)1192
Transcript length (bp)780
Coding sequence length (bp)777
Protein length (aa) 259

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01040 UbiA UbiA prenyltransferase family 8.8E-19 85 238

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8W405|PGT1_LITER 4-hydroxybenzoate geranyltransferase 1 OS=Lithospermum erythrorhizon GN=PGT-1 PE=1 SV=1 75 220 7.0E-12
sp|Q8W404|PGT2_LITER 4-hydroxybenzoate geranyltransferase 2 OS=Lithospermum erythrorhizon GN=PGT-2 PE=1 SV=1 75 220 1.0E-11
sp|Q9VHS7|COQ2_DROME 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Drosophila melanogaster GN=Coq2 PE=2 SV=1 89 233 4.0E-09
sp|Q298G6|COQ2_DROPS 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=Coq2 PE=3 SV=1 89 233 4.0E-09
sp|Q66JT7|COQ2_MOUSE 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Mus musculus GN=Coq2 PE=2 SV=2 80 245 8.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8W405|PGT1_LITER 4-hydroxybenzoate geranyltransferase 1 OS=Lithospermum erythrorhizon GN=PGT-1 PE=1 SV=1 75 220 7.0E-12
sp|Q8W404|PGT2_LITER 4-hydroxybenzoate geranyltransferase 2 OS=Lithospermum erythrorhizon GN=PGT-2 PE=1 SV=1 75 220 1.0E-11
sp|Q9VHS7|COQ2_DROME 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Drosophila melanogaster GN=Coq2 PE=2 SV=1 89 233 4.0E-09
sp|Q298G6|COQ2_DROPS 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=Coq2 PE=3 SV=1 89 233 4.0E-09
sp|Q66JT7|COQ2_MOUSE 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Mus musculus GN=Coq2 PE=2 SV=2 80 245 8.0E-09
sp|Q499N4|COQ2_RAT 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Rattus norvegicus GN=Coq2 PE=2 SV=1 80 220 5.0E-08
sp|Q96H96|COQ2_HUMAN 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Homo sapiens GN=COQ2 PE=1 SV=1 80 233 8.0E-08
sp|Q2KIQ4|COQ2_BOVIN 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Bos taurus GN=COQ2 PE=2 SV=1 80 220 8.0E-08
sp|Q16QL3|COQ2_AEDAE 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Aedes aegypti GN=coq2 PE=3 SV=1 86 220 2.0E-07
sp|B0BPA2|UBIA_ACTPJ 4-hydroxybenzoate octaprenyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=ubiA PE=3 SV=1 85 220 2.0E-06
sp|B3H1F9|UBIA_ACTP7 4-hydroxybenzoate octaprenyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ubiA PE=3 SV=1 86 220 2.0E-06
sp|A3N0I2|UBIA_ACTP2 4-hydroxybenzoate octaprenyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ubiA PE=3 SV=1 86 220 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups Yes
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 101 120 19
2 125 142 17
3 152 174 22
4 186 208 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3030
MMQSRQLLGFHTILTLHTRINNGGNDEKAYDTALVRPVAVQQIQSPLYYFCGSMVCAAGGSSRSCLAAPDCVASF
RASTNRPMFHSSDRPLAAGKITTTEAMIWMIFQLFLSWLVLNVMLEGKDVWKHLLPVMIASFLYPFGKRPMARML
YIYPQYILAFTIAWPAVLGRAAISARHDSFANTTRHCLPICTTVFFWTLYLNTAYSYQDVVDDRKLNVNSFYNIA
GRHTHALLVVLVSPILLDGSMDCGPDGAIASVRS
Coding >Ophio5|3030
ATGATGCAGTCAAGACAGCTTTTAGGCTTCCACACCATCTTGACTCTACACACGAGAATCAACAATGGCGGGAAC
GACGAAAAGGCATATGACACGGCACTTGTTCGCCCTGTCGCGGTTCAACAAATACAATCCCCTCTTTACTACTTT
TGCGGGAGCATGGTCTGCGCTGCTGGCGGGAGCAGCAGATCTTGCCTCGCAGCGCCCGACTGTGTCGCTTCTTTT
CGTGCTTCGACAAACCGCCCTATGTTTCATAGCAGCGATCGACCCTTGGCAGCCGGCAAGATCACGACAACCGAA
GCTATGATATGGATGATATTCCAGTTGTTTCTTTCTTGGCTGGTACTCAACGTGATGCTCGAAGGCAAAGACGTG
TGGAAGCATCTGCTGCCAGTCATGATTGCCTCATTTCTTTACCCTTTTGGAAAGAGACCCATGGCACGAATGCTA
TATATTTATCCCCAGTACATCTTGGCATTTACAATCGCATGGCCTGCTGTTCTGGGAAGGGCCGCCATTTCCGCT
CGGCATGATTCCTTCGCCAATACAACCCGCCACTGCCTACCAATCTGTACCACAGTATTCTTCTGGACCCTCTAC
CTGAATACAGCATACAGCTATCAAGATGTGGTCGACGATCGAAAGCTAAACGTCAACTCCTTTTACAACATCGCC
GGAAGACACACCCATGCCTTACTTGTGGTCCTAGTTAGTCCGATCTTGCTGGATGGGAGTATGGACTGCGGCCCT
GATGGTGCAATTGCTTCGGTTCGATCC
Transcript >Ophio5|3030
ATGATGCAGTCAAGACAGCTTTTAGGCTTCCACACCATCTTGACTCTACACACGAGAATCAACAATGGCGGGAAC
GACGAAAAGGCATATGACACGGCACTTGTTCGCCCTGTCGCGGTTCAACAAATACAATCCCCTCTTTACTACTTT
TGCGGGAGCATGGTCTGCGCTGCTGGCGGGAGCAGCAGATCTTGCCTCGCAGCGCCCGACTGTGTCGCTTCTTTT
CGTGCTTCGACAAACCGCCCTATGTTTCATAGCAGCGATCGACCCTTGGCAGCCGGCAAGATCACGACAACCGAA
GCTATGATATGGATGATATTCCAGTTGTTTCTTTCTTGGCTGGTACTCAACGTGATGCTCGAAGGCAAAGACGTG
TGGAAGCATCTGCTGCCAGTCATGATTGCCTCATTTCTTTACCCTTTTGGAAAGAGACCCATGGCACGAATGCTA
TATATTTATCCCCAGTACATCTTGGCATTTACAATCGCATGGCCTGCTGTTCTGGGAAGGGCCGCCATTTCCGCT
CGGCATGATTCCTTCGCCAATACAACCCGCCACTGCCTACCAATCTGTACCACAGTATTCTTCTGGACCCTCTAC
CTGAATACAGCATACAGCTATCAAGATGTGGTCGACGATCGAAAGCTAAACGTCAACTCCTTTTACAACATCGCC
GGAAGACACACCCATGCCTTACTTGTGGTCCTAGTTAGTCCGATCTTGCTGGATGGGAGTATGGACTGCGGCCCT
GATGGTGCAATTGCTTCGGTTCGATCCTAA
Gene >Ophio5|3030
ATGATGCAGTCAAGACAGTAACGTCGCGCTCGTCTATTCCACGACGACATAAGGTTTAAATGGCAAGGCAGTGCG
TTTCATTCAGACCCGCTCAGTTCACCGCAGAAGCTATAACGGGAGGAGCCCGCCCGCGAGAGTCCTCAATTTTAG
GCTTCGGAACTCGTGCGACCTAATTAGGCTTTTAGGCTTCCACACCATCTTGACTCTACACACGAGAATCAACAA
TGGCGGGAACGACGAAAAGGCATATGACACGGCACTTGTTCGCCCTGTCGCGGTTCAACAAATACAATCCCCTCT
TTACTACTTTTGCGGGAGGTACGTGGCTCACATCTTCACCACGCCGAGGTAGTCAACTGATGCTGCTTAAACATA
GCATGGTCTGCGCTGCTGGCGGGAGCAGCAGATCTTGCCTCGCAGCGCCCGACTGTGTCGCTTCTTTTCGTGCTT
CGACAAACCGCCCTATGTTTCATAGCAGCGTATGTATTTTGTGGCGCGGGTATGGTCTGGAACGATTGGATTGAT
CGCGATATCGATGCCAACGTTTCTCGGACAAAGGATCGACCCTTGGCAGCCGGCAAGATCACGACAACCGAAGCT
ATGATATGGATGATATTCCAGTTGTTTCTTTCTTGGCTGGTACTCAACGTGATGCTCGAAGGCAAAGACGTGTAA
GTGTGCAGATGAGGTATAGGGTCGAATCTTCGGGCGTCGGATTCTCACGCACGAACAGGTGGAAGCATCTGCTGC
CAGTCATGATTGCCTCATTTCTTTACCCTTTTGGAAAGAGACCCATGGCACGAATGCTATATATTTATCCCCAGT
ACATCTTGGCATTTACAATCGCATGGCCTGCTGTTCTGGGAAGGGCCGCCATTTCCGCTCGGCATGATTCCTTCG
CCAATACAACCCGCCACTGCCTACCAATCTGTACCACAGTATTCTTCTGGACCCTCTACCTGAATACAGCATACA
GCTATCAAGATGTGGTCGACGATCGAAAGCTAAACGTCAACTCCTTTTACAACATCGCCGGAAGACACACCCATG
CCTTACTTGTGGTCCTAGTTAGTCCGATCTTGGTGTGTCTGCCCCTGCATTTGGCGCAATTTCGCTCCTCATGGC
TGTGGATCAGCTGGATGGGAGTATGGACTGCGGCCCTGATGGTGCAATTGCTTCGGTTCGATCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail