Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3019
Gene name
Locationscaffold_24:58534..60622
Strand+
Gene length (bp)2088
Transcript length (bp)1914
Coding sequence length (bp)1911
Protein length (aa) 637

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01554 MatE MatE 3.2E-32 206 366
PF01554 MatE MatE 2.2E-20 428 585

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05497|YD338_YEAST Uncharacterized transporter YDR338C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR338C PE=1 SV=1 175 625 7.0E-119
sp|P38767|ERC1_YEAST Ethionine resistance-conferring protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERC1 PE=1 SV=1 96 566 9.0E-112
sp|Q9USK3|YJ2D_SCHPO Uncharacterized transporter C4B3.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4B3.13 PE=3 SV=1 142 625 1.0E-106
sp|Q9UT92|YL47_SCHPO Uncharacterized transporter C323.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC323.07c PE=1 SV=1 194 633 5.0E-92
sp|Q10085|YAO6_SCHPO Uncharacterized transporter C11D3.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.06 PE=3 SV=1 196 633 7.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05497|YD338_YEAST Uncharacterized transporter YDR338C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR338C PE=1 SV=1 175 625 7.0E-119
sp|P38767|ERC1_YEAST Ethionine resistance-conferring protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERC1 PE=1 SV=1 96 566 9.0E-112
sp|Q9USK3|YJ2D_SCHPO Uncharacterized transporter C4B3.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4B3.13 PE=3 SV=1 142 625 1.0E-106
sp|Q9UT92|YL47_SCHPO Uncharacterized transporter C323.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC323.07c PE=1 SV=1 194 633 5.0E-92
sp|Q10085|YAO6_SCHPO Uncharacterized transporter C11D3.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.06 PE=3 SV=1 196 633 7.0E-80
sp|Q3V050|S47A2_MOUSE Multidrug and toxin extrusion protein 2 OS=Mus musculus GN=Slc47a2 PE=1 SV=1 187 633 6.0E-71
sp|Q8K0H1|S47A1_MOUSE Multidrug and toxin extrusion protein 1 OS=Mus musculus GN=Slc47a1 PE=1 SV=2 195 630 1.0E-64
sp|Q5RFD2|S47A1_PONAB Multidrug and toxin extrusion protein 1 OS=Pongo abelii GN=SLC47A1 PE=2 SV=1 191 630 5.0E-64
sp|Q5I0E9|S47A1_RAT Multidrug and toxin extrusion protein 1 OS=Rattus norvegicus GN=Slc47a1 PE=1 SV=1 193 630 3.0E-62
sp|A4IIS8|S47A1_XENTR Multidrug and toxin extrusion protein 1 OS=Xenopus tropicalis GN=slc47a1 PE=2 SV=1 215 633 6.0E-61
sp|Q96FL8|S47A1_HUMAN Multidrug and toxin extrusion protein 1 OS=Homo sapiens GN=SLC47A1 PE=1 SV=1 191 630 1.0E-59
sp|Q9FHB6|DTX16_ARATH Protein DETOXIFICATION 16 OS=Arabidopsis thaliana GN=DTX16 PE=2 SV=1 190 633 8.0E-59
sp|F4IHU9|DTX15_ARATH Protein DETOXIFICATION 15 OS=Arabidopsis thaliana GN=DTX15 PE=3 SV=1 194 633 5.0E-57
sp|Q9C9U1|DTX17_ARATH Protein DETOXIFICATION 17 OS=Arabidopsis thaliana GN=DTX17 PE=2 SV=1 194 633 1.0E-56
sp|A1L1P9|S47A1_DANRE Multidrug and toxin extrusion protein 1 OS=Danio rerio GN=slc47a1 PE=2 SV=1 162 633 7.0E-56
sp|A7KAU2|S47A1_RABIT Multidrug and toxin extrusion protein 1 OS=Oryctolagus cuniculus GN=SLC47A1 PE=2 SV=1 193 630 1.0E-55
sp|Q86VL8|S47A2_HUMAN Multidrug and toxin extrusion protein 2 OS=Homo sapiens GN=SLC47A2 PE=1 SV=1 196 634 2.0E-53
sp|Q5R7E4|S47A2_PONAB Multidrug and toxin extrusion protein 2 OS=Pongo abelii GN=SLC47A2 PE=2 SV=1 196 634 2.0E-53
sp|Q9C994|DTX14_ARATH Protein DETOXIFICATION 14 OS=Arabidopsis thaliana GN=DTX14 PE=3 SV=1 195 633 9.0E-51
sp|Q9SZE2|DTX51_ARATH Protein DETOXIFICATION 51 OS=Arabidopsis thaliana GN=DTX51 PE=2 SV=1 196 636 5.0E-48
sp|A7KAU3|S47A2_RABIT Multidrug and toxin extrusion protein 2 OS=Oryctolagus cuniculus GN=SLC47A2 PE=1 SV=1 190 630 6.0E-48
sp|Q8GXM8|DTX2_ARATH Protein DETOXIFICATION 2 OS=Arabidopsis thaliana GN=DTX2 PE=2 SV=1 190 633 2.0E-47
sp|Q9C9M8|DTX9_ARATH Protein DETOXIFICATION 9 OS=Arabidopsis thaliana GN=DTX9 PE=2 SV=1 190 633 2.0E-47
sp|Q4PSF4|DTX52_ARATH Protein DETOXIFICATION 52 OS=Arabidopsis thaliana GN=DTX52 PE=2 SV=1 191 630 4.0E-47
sp|Q9ZVH5|DTX53_ARATH Protein DETOXIFICATION 53 OS=Arabidopsis thaliana GN=DTX53 PE=2 SV=1 195 636 3.0E-44
sp|Q9SIA4|DTX3_ARATH Protein DETOXIFICATION 3 OS=Arabidopsis thaliana GN=DTX3 PE=3 SV=1 190 633 9.0E-44
sp|Q8VYL8|DTX10_ARATH Protein DETOXIFICATION 10 OS=Arabidopsis thaliana GN=DTX10 PE=2 SV=1 196 635 4.0E-43
sp|Q9SIA3|DTX4_ARATH Protein DETOXIFICATION 4 OS=Arabidopsis thaliana GN=DTX4 PE=3 SV=2 190 633 4.0E-43
sp|Q9SIA5|DTX1_ARATH Protein DETOXIFICATION 1 OS=Arabidopsis thaliana GN=DTX1 PE=2 SV=1 190 633 2.0E-42
sp|F4HZH9|DTX11_ARATH Protein DETOXIFICATION 11 OS=Arabidopsis thaliana GN=DTX11 PE=3 SV=1 196 635 2.0E-41
sp|Q8RWF5|DTX6_ARATH Protein DETOXIFICATION 6 OS=Arabidopsis thaliana GN=DTX6 PE=2 SV=1 190 633 3.0E-41
sp|Q9LUH3|DTX18_ARATH Protein DETOXIFICATION 18 OS=Arabidopsis thaliana GN=DTX18 PE=2 SV=1 195 628 8.0E-41
sp|F4HQ05|DTX8_ARATH Protein DETOXIFICATION 8 OS=Arabidopsis thaliana GN=DTX8 PE=3 SV=1 214 633 1.0E-40
sp|Q9LVD9|DTX40_ARATH Protein DETOXIFICATION 40 OS=Arabidopsis thaliana GN=DTX40 PE=1 SV=1 188 633 1.0E-40
sp|Q8L731|DTX12_ARATH Protein DETOXIFICATION 12 OS=Arabidopsis thaliana GN=DTX12 PE=2 SV=1 196 635 2.0E-40
sp|Q9SLV0|DTX48_ARATH Protein DETOXIFICATION 48 OS=Arabidopsis thaliana GN=DTX48 PE=2 SV=1 195 630 8.0E-40
sp|Q9LUH2|DTX19_ARATH Protein DETOXIFICATION 19 OS=Arabidopsis thaliana GN=DTX19 PE=2 SV=1 195 625 8.0E-40
sp|Q9LE20|DTX54_ARATH Protein DETOXIFICATION 54 OS=Arabidopsis thaliana GN=DTX54 PE=2 SV=1 195 630 1.0E-39
sp|Q38956|DTX29_ARATH Protein DETOXIFICATION 29 OS=Arabidopsis thaliana GN=DTX29 PE=1 SV=1 196 633 1.0E-39
sp|Q94AL1|DTX13_ARATH Protein DETOXIFICATION 13 OS=Arabidopsis thaliana GN=DTX13 PE=2 SV=1 196 635 2.0E-39
sp|Q9SIA1|DTX5_ARATH Protein DETOXIFICATION 5 OS=Arabidopsis thaliana GN=DTX5 PE=3 SV=2 196 633 2.0E-38
sp|Q9SX83|DTX33_ARATH Protein DETOXIFICATION 33 OS=Arabidopsis thaliana GN=DTX33 PE=2 SV=1 195 633 3.0E-38
sp|Q9SAB0|DTX36_ARATH Protein DETOXIFICATION 36 OS=Arabidopsis thaliana GN=DTX36 PE=2 SV=1 196 633 4.0E-38
sp|O80695|DTX37_ARATH Protein DETOXIFICATION 37 OS=Arabidopsis thaliana GN=DTX37 PE=2 SV=1 188 633 5.0E-38
sp|Q9LS19|DTX30_ARATH Protein DETOXIFICATION 30 OS=Arabidopsis thaliana GN=DTX30 PE=2 SV=1 187 633 4.0E-37
sp|Q9LYT3|DTX41_ARATH Protein DETOXIFICATION 41 OS=Arabidopsis thaliana GN=DTX41 PE=2 SV=1 196 633 6.0E-37
sp|Q9LPV4|DTX31_ARATH Protein DETOXIFICATION 31 OS=Arabidopsis thaliana GN=DTX31 PE=2 SV=1 196 633 2.0E-36
sp|F4JKB9|DTX38_ARATH Protein DETOXIFICATION 38 OS=Arabidopsis thaliana GN=DTX38 PE=2 SV=1 220 633 6.0E-36
sp|O82752|DTX49_ARATH Protein DETOXIFICATION 49 OS=Arabidopsis thaliana GN=DTX49 PE=2 SV=1 195 637 8.0E-36
sp|Q8W488|DTX21_ARATH Protein DETOXIFICATION 21 OS=Arabidopsis thaliana GN=DTX21 PE=1 SV=1 160 633 3.0E-35
sp|Q8RXK1|DTX23_ARATH Protein DETOXIFICATION 23 OS=Arabidopsis thaliana GN=DTX23 PE=2 SV=1 150 633 3.0E-35
sp|Q940N9|DTX39_ARATH Protein DETOXIFICATION 39 OS=Arabidopsis thaliana GN=DTX39 PE=2 SV=1 196 633 6.0E-35
sp|Q1PFG9|DTX7_ARATH Protein DETOXIFICATION 7 OS=Arabidopsis thaliana GN=DTX7 PE=2 SV=1 198 633 5.0E-34
sp|Q9FJ87|DTX50_ARATH Protein DETOXIFICATION 50 OS=Arabidopsis thaliana GN=DTX50 PE=2 SV=1 191 636 2.0E-33
sp|F4I4Q3|DTX32_ARATH Protein DETOXIFICATION 32 OS=Arabidopsis thaliana GN=DTX32 PE=3 SV=1 196 633 2.0E-33
sp|Q9FH21|DTX55_ARATH Protein DETOXIFICATION 55 OS=Arabidopsis thaliana GN=DTX55 PE=2 SV=1 195 630 9.0E-33
sp|F4HPH1|DTX22_ARATH Protein DETOXIFICATION 22 OS=Arabidopsis thaliana GN=DTX22 PE=2 SV=1 160 630 1.0E-32
sp|Q9FKQ1|DTX27_ARATH Protein DETOXIFICATION 27 OS=Arabidopsis thaliana GN=DTX27 PE=2 SV=1 196 633 2.0E-32
sp|F4JH46|DTX34_ARATH Protein DETOXIFICATION 34 OS=Arabidopsis thaliana GN=DTX34 PE=2 SV=1 196 633 2.0E-32
sp|F4JTB3|DTX35_ARATH Protein DETOXIFICATION 35 OS=Arabidopsis thaliana GN=DTX35 PE=2 SV=1 170 633 5.0E-32
sp|F4HPH2|DTX20_ARATH Protein DETOXIFICATION 20 OS=Arabidopsis thaliana GN=DTX20 PE=3 SV=1 181 634 2.0E-31
sp|O49660|DTX56_ARATH Protein DETOXIFICATION 56 OS=Arabidopsis thaliana GN=DTX56 PE=1 SV=1 171 630 1.0E-29
sp|Q8L616|DTX25_ARATH Protein DETOXIFICATION 25 OS=Arabidopsis thaliana GN=DTX25 PE=2 SV=1 164 633 9.0E-29
sp|Q1PDX9|DTX26_ARATH Protein DETOXIFICATION 26 OS=Arabidopsis thaliana GN=DTX26 PE=2 SV=1 185 606 4.0E-28
sp|Q9FNC1|DTX28_ARATH Protein DETOXIFICATION 28 OS=Arabidopsis thaliana GN=DTX28 PE=3 SV=1 153 633 8.0E-26
sp|F4J158|DTX24_ARATH Protein DETOXIFICATION 24 OS=Arabidopsis thaliana GN=DTX24 PE=2 SV=1 216 633 6.0E-24
sp|Q9I3Y3|PMPM_PSEAE Multidrug resistance protein PmpM OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pmpM PE=3 SV=1 196 613 4.0E-22
sp|Q7MKP8|NORM_VIBVY Multidrug resistance protein NorM OS=Vibrio vulnificus (strain YJ016) GN=norM PE=3 SV=2 193 607 4.0E-22
sp|O82855|NORM_VIBPA Multidrug resistance protein NorM OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=norM PE=1 SV=2 193 613 5.0E-22
sp|Q8D9N8|NORM_VIBVU Multidrug resistance protein NorM OS=Vibrio vulnificus (strain CMCP6) GN=norM PE=3 SV=2 193 607 1.0E-21
sp|Q9KEJ2|NORM_BACHD Probable multidrug resistance protein NorM OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=norM PE=3 SV=1 192 612 2.0E-21
sp|Q5E4Y6|NORM_VIBF1 Multidrug resistance protein NorM OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=norM PE=3 SV=1 193 624 1.0E-20
sp|Q5KZL2|NORM_GEOKA Probable multidrug resistance protein NorM OS=Geobacillus kaustophilus (strain HTA426) GN=norM PE=3 SV=1 193 607 1.0E-20
sp|Q73BB8|NORM_BACC1 Probable multidrug resistance protein NorM OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=norM PE=3 SV=1 191 607 8.0E-20
sp|Q9KRU4|NORM_VIBCH Multidrug resistance protein NorM OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=norM PE=3 SV=2 193 607 8.0E-20
sp|Q7WAK9|NORM_BORPA Probable multidrug resistance protein NorM OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=norM PE=3 SV=1 190 622 2.0E-19
sp|Q8CUL5|NORM_OCEIH Probable multidrug resistance protein NorM OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=norM PE=3 SV=2 214 607 2.0E-19
sp|Q7WJR0|NORM_BORBR Probable multidrug resistance protein NorM OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=norM PE=3 SV=1 190 622 2.0E-19
sp|Q6HLG9|NORM_BACHK Probable multidrug resistance protein NorM OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=norM PE=3 SV=1 314 607 2.0E-19
sp|Q81T85|NORM_BACAN Probable multidrug resistance protein NorM OS=Bacillus anthracis GN=norM PE=3 SV=1 314 607 3.0E-19
sp|Q6LQ49|NORM_PHOPR Multidrug resistance protein NorM OS=Photobacterium profundum GN=norM PE=3 SV=1 192 613 3.0E-19
sp|Q8Y654|NORM_LISMO Probable multidrug resistance protein NorM OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=norM PE=3 SV=1 192 613 4.0E-19
sp|Q92AG2|NORM_LISIN Probable multidrug resistance protein NorM OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=norM PE=3 SV=1 192 613 6.0E-19
sp|Q71YH0|NORM_LISMF Probable multidrug resistance protein NorM OS=Listeria monocytogenes serotype 4b (strain F2365) GN=norM PE=3 SV=1 192 613 7.0E-19
sp|P45272|HMRM_HAEIN Multidrug resistance protein HmrM OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hmrM PE=3 SV=1 188 607 1.0E-17
sp|Q7N1G0|NORM_PHOLL Probable multidrug resistance protein NorM OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=norM PE=3 SV=1 191 618 2.0E-17
sp|Q63DZ4|NORM_BACCZ Probable multidrug resistance protein NorM OS=Bacillus cereus (strain ZK / E33L) GN=norM PE=3 SV=1 314 607 2.0E-17
sp|Q81G28|NORM_BACCR Probable multidrug resistance protein NorM OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=norM PE=3 SV=1 191 607 3.0E-17
sp|Q8UDF5|NORM_AGRFC Probable multidrug resistance protein NorM OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=norM PE=3 SV=1 182 613 7.0E-15
sp|Q6D5W6|MDTK_PECAS Multidrug resistance protein MdtK OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtK PE=3 SV=1 196 616 3.0E-14
sp|A1JPA1|MDTK_YERE8 Multidrug resistance protein MdtK OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtK PE=3 SV=1 196 613 3.0E-14
sp|Q6NB79|NORM_RHOPA Probable multidrug resistance protein NorM OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=norM PE=3 SV=1 191 609 7.0E-14
sp|A7FHJ7|MDTK_YERP3 Multidrug resistance protein MdtK OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mdtK PE=3 SV=1 196 613 9.0E-14
sp|B1JJ53|MDTK_YERPY Multidrug resistance protein MdtK OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mdtK PE=3 SV=1 196 613 9.0E-14
sp|Q66A27|MDTK_YERPS Multidrug resistance protein MdtK OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mdtK PE=3 SV=1 196 613 9.0E-14
sp|A4TIP9|MDTK_YERPP Multidrug resistance protein MdtK OS=Yersinia pestis (strain Pestoides F) GN=mdtK PE=3 SV=1 196 613 9.0E-14
sp|Q1CIK5|MDTK_YERPN Multidrug resistance protein MdtK OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mdtK PE=3 SV=1 196 613 9.0E-14
sp|A9QZC0|MDTK_YERPG Multidrug resistance protein MdtK OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdtK PE=3 SV=1 196 613 9.0E-14
sp|Q8ZDZ8|MDTK_YERPE Multidrug resistance protein MdtK OS=Yersinia pestis GN=mdtK PE=3 SV=1 196 613 9.0E-14
sp|B2K5I9|MDTK_YERPB Multidrug resistance protein MdtK OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mdtK PE=3 SV=1 196 613 9.0E-14
sp|Q1C769|MDTK_YERPA Multidrug resistance protein MdtK OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mdtK PE=3 SV=1 196 613 9.0E-14
sp|Q6FEY7|NORM_ACIAD Probable multidrug resistance protein NorM OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=norM PE=3 SV=1 196 617 1.0E-13
sp|Q9CMZ9|NORM_PASMU Probable multidrug resistance protein NorM OS=Pasteurella multocida (strain Pm70) GN=norM PE=3 SV=1 214 607 3.0E-13
sp|Q5NYX9|NORM_AROAE Probable multidrug resistance protein NorM OS=Aromatoleum aromaticum (strain EbN1) GN=norM PE=3 SV=1 206 613 4.0E-13
sp|O31855|NORM_BACSU Probable multidrug resistance protein NorM OS=Bacillus subtilis (strain 168) GN=norM PE=3 SV=1 253 607 4.0E-13
sp|Q63S57|NORM_BURPS Probable multidrug resistance protein NorM OS=Burkholderia pseudomallei (strain K96243) GN=norM PE=3 SV=1 192 613 7.0E-13
sp|Q98D15|NORM_RHILO Probable multidrug resistance protein NorM OS=Rhizobium loti (strain MAFF303099) GN=norM PE=3 SV=1 193 622 1.0E-12
sp|Q7VMB5|NORM_HAEDU Probable multidrug resistance protein NorM OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=norM PE=3 SV=1 189 607 2.0E-12
sp|Q9JV27|NORM_NEIMA Probable multidrug resistance protein NorM OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=norM PE=3 SV=1 191 612 2.0E-12
sp|Q62LW6|NORM_BURMA Probable multidrug resistance protein NorM OS=Burkholderia mallei (strain ATCC 23344) GN=norM PE=3 SV=1 192 613 1.0E-11
sp|Q8G2I1|NORM_BRUSU Probable multidrug resistance protein NorM OS=Brucella suis biovar 1 (strain 1330) GN=norM PE=3 SV=1 193 636 1.0E-11
sp|Q8YFD7|NORM_BRUME Probable multidrug resistance protein NorM OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=norM PE=3 SV=1 193 636 1.0E-11
sp|Q65SY9|NORM_MANSM Probable multidrug resistance protein NorM OS=Mannheimia succiniciproducens (strain MBEL55E) GN=norM PE=3 SV=1 191 615 3.0E-11
sp|C5BDY7|MDTK_EDWI9 Multidrug resistance protein MdtK OS=Edwardsiella ictaluri (strain 93-146) GN=mdtK PE=3 SV=1 193 613 4.0E-11
sp|A4W9T2|MDTK_ENT38 Multidrug resistance protein MdtK OS=Enterobacter sp. (strain 638) GN=mdtK PE=3 SV=1 193 613 4.0E-11
sp|Q7N3V2|MDTK_PHOLL Multidrug resistance protein MdtK OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=mdtK PE=3 SV=1 195 625 4.0E-11
sp|Q9F5N7|NORM_BURVI Multidrug resistance protein NorM OS=Burkholderia vietnamiensis GN=norM PE=3 SV=1 194 613 5.0E-11
sp|Q65IG9|NORM_BACLD Probable multidrug resistance protein NorM OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=norM PE=3 SV=1 296 607 5.0E-11
sp|Q9K015|NORM_NEIMB Probable multidrug resistance protein NorM OS=Neisseria meningitidis serogroup B (strain MC58) GN=norM PE=3 SV=1 195 612 5.0E-11
sp|Q8DPQ6|NORM_STRR6 Probable multidrug resistance protein NorM OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=norM PE=3 SV=1 206 609 8.0E-11
sp|Q7NXN3|NORM_CHRVO Probable multidrug resistance protein NorM OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=norM PE=3 SV=1 196 618 2.0E-10
sp|A9MEJ6|MDTK_SALAR Multidrug resistance protein MdtK OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mdtK PE=3 SV=1 193 613 3.0E-10
sp|B4TH65|MDTK_SALHS Multidrug resistance protein MdtK OS=Salmonella heidelberg (strain SL476) GN=mdtK PE=3 SV=1 193 613 4.0E-10
sp|B4T562|MDTK_SALNS Multidrug resistance protein MdtK OS=Salmonella newport (strain SL254) GN=mdtK PE=3 SV=1 193 613 4.0E-10
sp|Q8Z6N7|MDTK_SALTI Multidrug resistance protein MdtK OS=Salmonella typhi GN=mdtK PE=3 SV=1 193 613 5.0E-10
sp|C0Q5V7|MDTK_SALPC Multidrug resistance protein MdtK OS=Salmonella paratyphi C (strain RKS4594) GN=mdtK PE=3 SV=1 193 613 5.0E-10
sp|B5FIH8|MDTK_SALDC Multidrug resistance protein MdtK OS=Salmonella dublin (strain CT_02021853) GN=mdtK PE=3 SV=1 193 613 5.0E-10
sp|B4TUY3|MDTK_SALSV Multidrug resistance protein MdtK OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtK PE=3 SV=1 193 613 6.0E-10
sp|A9N0Y8|MDTK_SALPB Multidrug resistance protein MdtK OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtK PE=3 SV=1 193 613 6.0E-10
sp|B5F6M2|MDTK_SALA4 Multidrug resistance protein MdtK OS=Salmonella agona (strain SL483) GN=mdtK PE=3 SV=1 193 613 6.0E-10
sp|Q92PZ0|NORM_RHIME Probable multidrug resistance protein NorM OS=Rhizobium meliloti (strain 1021) GN=norM PE=3 SV=1 191 590 6.0E-10
sp|B5RAN4|MDTK_SALG2 Multidrug resistance protein MdtK OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=mdtK PE=3 SV=1 193 613 7.0E-10
sp|B5QV34|MDTK_SALEP Multidrug resistance protein MdtK OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtK PE=3 SV=1 193 613 7.0E-10
sp|B5BKE4|MDTK_SALPK Multidrug resistance protein MdtK OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtK PE=3 SV=1 193 613 8.0E-10
sp|Q5PH16|MDTK_SALPA Multidrug resistance protein MdtK OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtK PE=3 SV=1 193 613 8.0E-10
sp|Q57PL1|MDTK_SALCH Multidrug resistance protein MdtK OS=Salmonella choleraesuis (strain SC-B67) GN=mdtK PE=3 SV=1 193 613 8.0E-10
sp|Q8ZPP2|MDTK_SALTY Multidrug resistance protein MdtK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtK PE=3 SV=1 193 613 8.0E-10
sp|B5XWL3|MDTK_KLEP3 Multidrug resistance protein MdtK OS=Klebsiella pneumoniae (strain 342) GN=mdtK PE=3 SV=1 196 613 9.0E-10
sp|Q9RY44|NORM_DEIRA Probable multidrug resistance protein NorM OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=norM PE=3 SV=1 196 612 1.0E-09
sp|Q88CB9|NORM_PSEPK Probable multidrug resistance protein NorM OS=Pseudomonas putida (strain KT2440) GN=norM PE=3 SV=1 311 612 1.0E-09
sp|Q8EES3|NORM_SHEON Probable multidrug resistance protein NorM OS=Shewanella oneidensis (strain MR-1) GN=norM PE=3 SV=1 196 618 2.0E-09
sp|Q5QWR6|NORM_IDILO Probable multidrug resistance protein NorM OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=norM PE=3 SV=1 191 607 5.0E-09
sp|Q97QN5|NORM_STRPN Probable multidrug resistance protein NorM OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=norM PE=3 SV=1 206 609 1.0E-08
sp|A8AH48|MDTK_CITK8 Multidrug resistance protein MdtK OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtK PE=3 SV=1 196 613 2.0E-08
sp|Q9HTR0|NORM_PSEAE Probable multidrug resistance protein NorM OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=norM PE=3 SV=1 319 634 2.0E-08
sp|Q89W72|NORM_BRADU Probable multidrug resistance protein NorM OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=norM PE=3 SV=1 204 606 2.0E-08
sp|Q9PA34|NORM_XYLFA Probable multidrug resistance protein NorM OS=Xylella fastidiosa (strain 9a5c) GN=norM PE=3 SV=1 420 613 2.0E-08
sp|Q89AX2|NORM_BUCBP Probable multidrug resistance protein NorM OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=norM PE=3 SV=1 195 612 2.0E-08
sp|Q879Z5|NORM_XYLFT Probable multidrug resistance protein NorM OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=norM PE=3 SV=1 420 613 2.0E-08
sp|Q0T4A9|MDTK_SHIF8 Multidrug resistance protein MdtK OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtK PE=3 SV=1 196 613 4.0E-08
sp|Q7UAH8|MDTK_SHIFL Multidrug resistance protein MdtK OS=Shigella flexneri GN=mdtK PE=3 SV=1 196 613 1.0E-07
sp|Q8PG07|NORM_XANAC Probable multidrug resistance protein NorM OS=Xanthomonas axonopodis pv. citri (strain 306) GN=norM PE=3 SV=1 420 613 2.0E-07
sp|B1IQ91|MDTK_ECOLC Multidrug resistance protein MdtK OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtK PE=3 SV=1 196 613 2.0E-07
sp|A8A0L0|MDTK_ECOHS Multidrug resistance protein MdtK OS=Escherichia coli O9:H4 (strain HS) GN=mdtK PE=3 SV=1 196 613 2.0E-07
sp|B5Z497|MDTK_ECO5E Multidrug resistance protein MdtK OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtK PE=3 SV=1 196 613 2.0E-07
sp|P58164|MDTK_ECO57 Multidrug resistance protein MdtK OS=Escherichia coli O157:H7 GN=mdtK PE=3 SV=1 196 613 2.0E-07
sp|P37340|MDTK_ECOLI Multidrug resistance protein MdtK OS=Escherichia coli (strain K12) GN=mdtK PE=1 SV=2 196 613 3.0E-07
sp|Q0THG4|MDTK_ECOL5 Multidrug resistance protein MdtK OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtK PE=3 SV=1 196 613 3.0E-07
sp|B1XFX3|MDTK_ECODH Multidrug resistance protein MdtK OS=Escherichia coli (strain K12 / DH10B) GN=mdtK PE=3 SV=1 196 613 3.0E-07
sp|C4ZYC7|MDTK_ECOBW Multidrug resistance protein MdtK OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtK PE=3 SV=1 196 613 3.0E-07
sp|B7MV43|MDTK_ECO81 Multidrug resistance protein MdtK OS=Escherichia coli O81 (strain ED1a) GN=mdtK PE=3 SV=1 196 613 3.0E-07
sp|B7US04|MDTK_ECO27 Multidrug resistance protein MdtK OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtK PE=3 SV=1 196 613 3.0E-07
sp|Q3Z218|MDTK_SHISS Multidrug resistance protein MdtK OS=Shigella sonnei (strain Ss046) GN=mdtK PE=3 SV=1 196 613 3.0E-07
sp|Q321C2|MDTK_SHIBS Multidrug resistance protein MdtK OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtK PE=3 SV=1 196 613 3.0E-07
sp|Q1RBD2|MDTK_ECOUT Multidrug resistance protein MdtK OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtK PE=3 SV=1 196 613 3.0E-07
sp|Q8FH68|MDTK_ECOL6 Multidrug resistance protein MdtK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtK PE=3 SV=1 196 613 3.0E-07
sp|A1ABK4|MDTK_ECOK1 Multidrug resistance protein MdtK OS=Escherichia coli O1:K1 / APEC GN=mdtK PE=3 SV=1 196 613 3.0E-07
sp|B7MA17|MDTK_ECO45 Multidrug resistance protein MdtK OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtK PE=3 SV=1 196 613 3.0E-07
sp|B1LEM1|MDTK_ECOSM Multidrug resistance protein MdtK OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtK PE=3 SV=1 196 613 3.0E-07
sp|B7NBB6|MDTK_ECOLU Multidrug resistance protein MdtK OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtK PE=3 SV=1 196 613 3.0E-07
sp|Q5HIW0|MEPA_STAAC Multidrug export protein MepA OS=Staphylococcus aureus (strain COL) GN=mepA PE=3 SV=1 298 565 3.0E-07
sp|Q2G140|MEPA_STAA8 Multidrug export protein MepA OS=Staphylococcus aureus (strain NCTC 8325) GN=mepA PE=1 SV=1 298 565 3.0E-07
sp|Q2FJS9|MEPA_STAA3 Multidrug export protein MepA OS=Staphylococcus aureus (strain USA300) GN=mepA PE=3 SV=1 298 565 3.0E-07
sp|Q88BA2|NORM_PSESM Probable multidrug resistance protein NorM OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=norM PE=3 SV=1 252 626 3.0E-07
sp|B2U2G8|MDTK_SHIB3 Multidrug resistance protein MdtK OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtK PE=3 SV=1 196 613 3.0E-07
sp|B7M0M0|MDTK_ECO8A Multidrug resistance protein MdtK OS=Escherichia coli O8 (strain IAI1) GN=mdtK PE=3 SV=1 196 613 3.0E-07
sp|B7NTX0|MDTK_ECO7I Multidrug resistance protein MdtK OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtK PE=3 SV=1 196 613 3.0E-07
sp|B7L5L6|MDTK_ECO55 Multidrug resistance protein MdtK OS=Escherichia coli (strain 55989 / EAEC) GN=mdtK PE=3 SV=1 196 613 3.0E-07
sp|A7ZMC9|MDTK_ECO24 Multidrug resistance protein MdtK OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtK PE=3 SV=1 196 613 3.0E-07
sp|B6IBA3|MDTK_ECOSE Multidrug resistance protein MdtK OS=Escherichia coli (strain SE11) GN=mdtK PE=3 SV=1 196 613 4.0E-07
sp|Q2YVH4|MEPA_STAAB Multidrug export protein MepA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=mepA PE=3 SV=1 198 565 5.0E-07
sp|Q7A7N0|MEPA_STAAN Multidrug export protein MepA OS=Staphylococcus aureus (strain N315) GN=mepA PE=1 SV=1 298 565 1.0E-06
sp|Q99WP2|MEPA_STAAM Multidrug export protein MepA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=mepA PE=3 SV=1 298 565 1.0E-06
sp|Q6GJY2|MEPA_STAAR Multidrug export protein MepA OS=Staphylococcus aureus (strain MRSA252) GN=mepA PE=3 SV=1 298 565 1.0E-06
sp|Q55364|NORM_SYNY3 Probable multidrug resistance protein NorM OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=norM PE=3 SV=1 189 612 1.0E-06
sp|Q8NYB0|MEPA_STAAW Multidrug export protein MepA OS=Staphylococcus aureus (strain MW2) GN=mepA PE=3 SV=1 298 565 5.0E-06
sp|Q6GCD7|MEPA_STAAS Multidrug export protein MepA OS=Staphylococcus aureus (strain MSSA476) GN=mepA PE=3 SV=1 298 565 5.0E-06
sp|Q49VC5|MEPA_STAS1 Multidrug export protein MepA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=mepA PE=3 SV=1 198 565 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0042910 xenobiotic transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0015297 antiporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0015291 secondary active transmembrane transporter activity No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0022857 transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0022804 active transmembrane transporter activity No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 201 223 22
2 233 255 22
3 281 298 17
4 313 333 20
5 346 368 22
6 378 400 22
7 499 521 22
8 531 553 22
9 574 592 18
10 597 619 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3019
MDRGRPIPSPGYASPGRPQPGSLRILSASPLADDIAACSEADDDDDDDDDDDDFTDDALAVHGHGMYRRPSGVAY
GTSRPVFNQHPLEEPFLSPLERKQSRDAERSLLRDNRVLPPKHPSQAKSKSLLARSYRRLFSTRVPPSDDVDGPI
PRRRPTERTSLLDGDADDGLADGDELEQQWEEAVASGRLRTTWQRETKTVVAYSVPLVVTFFLQYSISVASIFAV
GRIGKLELGAVSLASMTMSVTCLAPFMGLATSLDTLCAQAYGSGHKHLVGLQCQRMVAFLSTLAAPIAILWLFSD
RILAHIVPDAESARLAGLYLKVMILAIPSIILFETGKRFLQAQGLFRATTSILLVAAPINILINWLLVWKAGLGF
VGAPIAVVITENLLPLLLVLYVIFVDGSQCWGGFSKRAMTNWWPMVKLALPGMIMVEAEWMAFEALTLIASRFGT
EYLAAQSALSTLATISYQIPFPVSIAASTRVANLIGAGMVDAARITAKVTFVAVCVVGIINLTIYSTLRFHLPML
FTNDEAVIAIVARTLPLVAVVQIFDGLGAGAHGLLRGVGKQSIGGPANLFAYYVISLPISLGLAFGADWKLVGMW
TGLTVGLVCVSIIEYTYLLMTDWNQAAAEAAARNAAG
Coding >Ophio5|3019
ATGGATCGCGGTCGGCCAATTCCTTCGCCCGGTTACGCCTCTCCCGGCAGGCCGCAGCCCGGGTCGCTTCGCATC
TTGTCCGCATCGCCCCTGGCCGACGACATAGCCGCCTGCTCCGAGGCCGACGACGACGACGACGACGACGACGAC
GACGACGATTTCACCGACGACGCTTTGGCTGTCCATGGCCACGGCATGTATCGTCGCCCCAGCGGCGTCGCCTAT
GGGACCTCGCGACCCGTCTTCAATCAGCATCCCTTGGAGGAGCCCTTCCTGTCGCCGCTGGAGAGGAAGCAGTCT
CGCGACGCCGAGCGCAGCCTGCTCAGGGACAACCGCGTCCTGCCGCCCAAGCATCCATCACAGGCCAAGAGCAAG
AGTCTACTGGCCCGCAGCTACCGACGTCTCTTCAGCACTCGCGTGCCGCCCAGTGACGACGTCGATGGCCCGATT
CCTCGCCGACGGCCGACGGAACGCACCTCCCTCCTCGACGGCGATGCTGACGATGGCCTCGCCGACGGGGACGAG
CTCGAGCAGCAGTGGGAGGAGGCCGTGGCATCCGGCCGGCTGCGCACCACTTGGCAGCGGGAGACCAAGACCGTC
GTCGCCTACTCGGTGCCGCTCGTCGTTACCTTTTTCCTCCAGTACTCCATCAGCGTGGCCAGCATCTTTGCCGTT
GGCAGGATCGGCAAGCTCGAGCTGGGAGCTGTATCGCTTGCTTCGATGACCATGTCGGTGACCTGCCTGGCCCCC
TTCATGGGGCTCGCGACGAGTCTCGATACGTTGTGTGCCCAGGCCTACGGATCCGGGCACAAGCACCTTGTCGGG
CTCCAGTGCCAGCGCATGGTGGCCTTCCTGTCGACGTTGGCCGCACCCATCGCCATCCTGTGGCTGTTTTCCGAC
CGCATCCTTGCCCATATTGTGCCTGATGCCGAGTCTGCTCGACTAGCGGGTTTATACCTCAAGGTTATGATCTTG
GCCATACCGAGCATCATCCTCTTCGAGACGGGCAAGCGCTTCCTCCAAGCGCAGGGGCTCTTCCGGGCCACGACG
TCGATACTGCTCGTCGCAGCTCCCATTAATATCTTGATCAACTGGCTCCTGGTCTGGAAGGCCGGTCTGGGCTTC
GTGGGCGCCCCCATCGCCGTCGTCATCACGGAGAACCTGCTGCCTCTACTCCTCGTACTCTACGTCATATTCGTC
GACGGCTCCCAGTGCTGGGGAGGGTTTAGCAAGCGCGCCATGACCAACTGGTGGCCCATGGTCAAGTTGGCCTTG
CCAGGCATGATTATGGTCGAGGCCGAGTGGATGGCCTTTGAAGCTTTGACTCTCATCGCCAGCCGCTTCGGTACC
GAGTATCTGGCTGCCCAGAGTGCGCTGAGCACGCTGGCGACGATATCGTACCAGATCCCCTTTCCCGTGTCCATC
GCCGCCTCGACCAGGGTCGCGAACCTGATTGGGGCGGGCATGGTGGATGCGGCGCGAATCACGGCCAAGGTGACC
TTCGTGGCCGTCTGCGTCGTCGGCATCATCAACCTCACCATCTACAGCACGCTGCGCTTTCACCTTCCGATGCTC
TTCACCAACGACGAGGCCGTCATCGCCATCGTCGCCAGGACGCTTCCCCTCGTCGCCGTCGTCCAGATCTTTGAC
GGTCTCGGTGCCGGGGCCCACGGCCTCCTGCGCGGCGTCGGCAAGCAGAGCATCGGCGGGCCGGCCAACCTCTTC
GCCTACTACGTCATATCCCTGCCCATCTCGCTGGGTCTGGCTTTCGGCGCCGACTGGAAGCTGGTCGGAATGTGG
ACTGGCCTCACCGTTGGCCTGGTGTGCGTCTCCATCATCGAGTATACCTATCTTCTTATGACGGATTGGAATCAG
GCTGCTGCCGAGGCGGCGGCTCGAAACGCGGCTGGT
Transcript >Ophio5|3019
ATGGATCGCGGTCGGCCAATTCCTTCGCCCGGTTACGCCTCTCCCGGCAGGCCGCAGCCCGGGTCGCTTCGCATC
TTGTCCGCATCGCCCCTGGCCGACGACATAGCCGCCTGCTCCGAGGCCGACGACGACGACGACGACGACGACGAC
GACGACGATTTCACCGACGACGCTTTGGCTGTCCATGGCCACGGCATGTATCGTCGCCCCAGCGGCGTCGCCTAT
GGGACCTCGCGACCCGTCTTCAATCAGCATCCCTTGGAGGAGCCCTTCCTGTCGCCGCTGGAGAGGAAGCAGTCT
CGCGACGCCGAGCGCAGCCTGCTCAGGGACAACCGCGTCCTGCCGCCCAAGCATCCATCACAGGCCAAGAGCAAG
AGTCTACTGGCCCGCAGCTACCGACGTCTCTTCAGCACTCGCGTGCCGCCCAGTGACGACGTCGATGGCCCGATT
CCTCGCCGACGGCCGACGGAACGCACCTCCCTCCTCGACGGCGATGCTGACGATGGCCTCGCCGACGGGGACGAG
CTCGAGCAGCAGTGGGAGGAGGCCGTGGCATCCGGCCGGCTGCGCACCACTTGGCAGCGGGAGACCAAGACCGTC
GTCGCCTACTCGGTGCCGCTCGTCGTTACCTTTTTCCTCCAGTACTCCATCAGCGTGGCCAGCATCTTTGCCGTT
GGCAGGATCGGCAAGCTCGAGCTGGGAGCTGTATCGCTTGCTTCGATGACCATGTCGGTGACCTGCCTGGCCCCC
TTCATGGGGCTCGCGACGAGTCTCGATACGTTGTGTGCCCAGGCCTACGGATCCGGGCACAAGCACCTTGTCGGG
CTCCAGTGCCAGCGCATGGTGGCCTTCCTGTCGACGTTGGCCGCACCCATCGCCATCCTGTGGCTGTTTTCCGAC
CGCATCCTTGCCCATATTGTGCCTGATGCCGAGTCTGCTCGACTAGCGGGTTTATACCTCAAGGTTATGATCTTG
GCCATACCGAGCATCATCCTCTTCGAGACGGGCAAGCGCTTCCTCCAAGCGCAGGGGCTCTTCCGGGCCACGACG
TCGATACTGCTCGTCGCAGCTCCCATTAATATCTTGATCAACTGGCTCCTGGTCTGGAAGGCCGGTCTGGGCTTC
GTGGGCGCCCCCATCGCCGTCGTCATCACGGAGAACCTGCTGCCTCTACTCCTCGTACTCTACGTCATATTCGTC
GACGGCTCCCAGTGCTGGGGAGGGTTTAGCAAGCGCGCCATGACCAACTGGTGGCCCATGGTCAAGTTGGCCTTG
CCAGGCATGATTATGGTCGAGGCCGAGTGGATGGCCTTTGAAGCTTTGACTCTCATCGCCAGCCGCTTCGGTACC
GAGTATCTGGCTGCCCAGAGTGCGCTGAGCACGCTGGCGACGATATCGTACCAGATCCCCTTTCCCGTGTCCATC
GCCGCCTCGACCAGGGTCGCGAACCTGATTGGGGCGGGCATGGTGGATGCGGCGCGAATCACGGCCAAGGTGACC
TTCGTGGCCGTCTGCGTCGTCGGCATCATCAACCTCACCATCTACAGCACGCTGCGCTTTCACCTTCCGATGCTC
TTCACCAACGACGAGGCCGTCATCGCCATCGTCGCCAGGACGCTTCCCCTCGTCGCCGTCGTCCAGATCTTTGAC
GGTCTCGGTGCCGGGGCCCACGGCCTCCTGCGCGGCGTCGGCAAGCAGAGCATCGGCGGGCCGGCCAACCTCTTC
GCCTACTACGTCATATCCCTGCCCATCTCGCTGGGTCTGGCTTTCGGCGCCGACTGGAAGCTGGTCGGAATGTGG
ACTGGCCTCACCGTTGGCCTGGTGTGCGTCTCCATCATCGAGTATACCTATCTTCTTATGACGGATTGGAATCAG
GCTGCTGCCGAGGCGGCGGCTCGAAACGCGGCTGGTTGA
Gene >Ophio5|3019
ATGGATCGCGGTCGGCCAATTCCTTCGCCCGGTTACGCCTCTCCCGGCAGGCCGCAGCCCGGGTCGCTTCGCATC
TTGTCCGCATCGCCCCTGGCCGACGACATAGCCGCCTGCTCCGAGGCCGACGACGACGACGACGACGACGACGAC
GACGACGATTTCACCGACGACGCTTTGGCTGTCCATGGCCACGGCATGTATCGTCGCCCCAGCGGCGTCGCCTAT
GGGACCTCGCGACCCGTCTTCAATCAGCATCCCTTGGAGGAGCCCTTCCTGTCGCCGCTGGAGAGGAAGCAGTCT
CGCGACGCCGAGCGCAGCCTGCTCAGGGACAACCGCGTCCTGCCGCCCAAGCATCCATCACAGGCCAAGAGCAAG
AGTCTACTGGCCCGCAGCTACCGACGTCTCTTCAGCACTCGCGTGCCGCCCAGTGACGACGTCGATGGCCCGATT
CCTCGCCGACGGCCGACGGAACGCACCTCCCTCCTCGACGGCGATGCTGACGATGGCCTCGCCGACGGGGACGAG
CTCGAGCAGCAGTGGGAGGAGGCCGTGGCATCCGGCCGGCTGCGCACCACTTGGCAGCGGGAGACCAAGACCGTC
GTCGCCTACTCGGTGCCGCTCGTCGTTACCTTTTTCCTCCAGTACTCCATCAGCGTGGCCAGCATCTTTGCCGTT
GGCAGGATCGGCAAGCTCGAGCTGGGAGCTGTATCGCGTGAGAGGCCCTCGCTGATGCCGTGAGTCTGCTCTTGC
TGACCCGCTCAGTTGCTTCGATGACCATGTCGGTGACCTGCCTGGCCCCCTTCATGGGGCTCGCGACGAGTCTCG
ATACGTTGTGTGCCCAGGCCTACGGATCCGGGCACAAGCACCTTGTCGGGCTCCAGTGCCAGCGCATGGTGGCCT
TCCTGTCGACGTTGGCCGCACCCATCGCCATCCTGTGGCTGTTTTCCGACCGCATCCTTGCCCATATTGTGCCTG
ATGCCGAGTCTGCTCGACTAGCGGGTTTATACCTCAAGGTTATGATCTTGGCCATACCGAGCATCATCCTCTTCG
AGACGGGCAAGCGCTTCCTCCAAGCGCAGGGGCTCTTCCGGGCCACGACGTCGATACTGCTCGTCGCAGCTCCCA
TTAATATCTTGATCAACTGGCTCCTGGTCTGGAAGGCCGGTCTGGGCTTCGTGGGCGCCCCCATCGCCGTCGTCA
TCACGGAGAACCTGCTGCCTCTACTCCTCGTACTCTACGTCATATTCGTCGACGGCTCCCAGTGCTGGGGAGGGT
TTAGCAAGCGCGCCATGACCAACTGGTGGCCCATGGTCAAGTTGGCCTTGCCAGGCATGATTATGGTCGAGGCCG
AGTGGATGGCCTTTGAAGCTTTGACTCTCATCGCCAGCCGCTTCGGTACCGAGTATCTGGCTGCCCAGAGTGCGC
TGAGCACGCTGGCGACGATATCGTACCAGATCCCCTTTCCCGTGTCCATCGCCGCCTCGACCAGGGTCGCGAACC
TGATTGGGGCGGGCATGGTGGATGCGGCGCGAATCACGGCCAAGGTGGTATGTCTTCCCCTTCCGTCTCGCCCTC
GTCGTCAGAGCTTTGACATGGAAGGCGTGCACCAGACCTTCGTGGCCGTCTGCGTCGTCGGCATCATCAACCTCA
CCATCTACAGCACGCTGCGCTTTCACCTTCCGATGCTCTTCACCAACGACGAGGCCGTCATCGCCATCGTCGCCA
GGACGCTTCCCCTCGTCGCCGTCGTCCAGATCTTTGACGGTCTCGGTGCCGGGGCCCACGGCCTCCTGCGCGGCG
TCGGCAAGCAGAGCATCGGCGGGCCGGCCAACCTCTTCGCCTACTACGTCATATCCCTGCCCATCTCGCTGGGTC
TGGCTTTCGGCGCCGACTGGAAGCTGGTCGGAATGTGGACTGGCCTCACCGTTGGCCTGGTGTGGTGAGATTTTC
GTTTTCGGGTTGTGGGAAGTTGGAGAGGTCTGGGCTGACTTTGTGAACAGCGTCTCCATCATCGAGTATACCTAT
CTTCTTATGACGGATTGGAATCAGGCTGCTGCCGAGGCGGCGGCTCGAAACGCGGCTGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail