Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3018
Gene name
Locationscaffold_24:56620..58348
Strand+
Gene length (bp)1728
Transcript length (bp)1614
Coding sequence length (bp)1611
Protein length (aa) 537

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06087 Tyr-DNA_phospho Tyrosyl-DNA phosphodiesterase 1.5E-160 70 510

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USG9|TYDP1_SCHPO Probable tyrosyl-DNA phosphodiesterase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCP31B10.05 PE=3 SV=1 52 532 3.0E-74
sp|Q4G056|TYDP1_RAT Tyrosyl-DNA phosphodiesterase 1 OS=Rattus norvegicus GN=Tdp1 PE=1 SV=1 73 532 2.0E-62
sp|Q9NUW8|TYDP1_HUMAN Tyrosyl-DNA phosphodiesterase 1 OS=Homo sapiens GN=TDP1 PE=1 SV=2 68 532 3.0E-60
sp|Q8BJ37|TYDP1_MOUSE Tyrosyl-DNA phosphodiesterase 1 OS=Mus musculus GN=Tdp1 PE=1 SV=2 68 532 9.0E-59
sp|Q9VQM4|TYDP1_DROME Probable tyrosyl-DNA phosphodiesterase OS=Drosophila melanogaster GN=gkt PE=2 SV=1 68 517 9.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USG9|TYDP1_SCHPO Probable tyrosyl-DNA phosphodiesterase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCP31B10.05 PE=3 SV=1 52 532 3.0E-74
sp|Q4G056|TYDP1_RAT Tyrosyl-DNA phosphodiesterase 1 OS=Rattus norvegicus GN=Tdp1 PE=1 SV=1 73 532 2.0E-62
sp|Q9NUW8|TYDP1_HUMAN Tyrosyl-DNA phosphodiesterase 1 OS=Homo sapiens GN=TDP1 PE=1 SV=2 68 532 3.0E-60
sp|Q8BJ37|TYDP1_MOUSE Tyrosyl-DNA phosphodiesterase 1 OS=Mus musculus GN=Tdp1 PE=1 SV=2 68 532 9.0E-59
sp|Q9VQM4|TYDP1_DROME Probable tyrosyl-DNA phosphodiesterase OS=Drosophila melanogaster GN=gkt PE=2 SV=1 68 517 9.0E-43
sp|Q9TXV7|TYDP1_CAEEL Probable tyrosyl-DNA phosphodiesterase OS=Caenorhabditis elegans GN=F52C12.1 PE=3 SV=1 50 532 8.0E-40
sp|Q8H1D9|TYDP1_ARATH Tyrosyl-DNA phosphodiesterase 1 OS=Arabidopsis thaliana GN=TDP1 PE=1 SV=1 37 532 2.0E-39
sp|P38319|TYDP1_YEAST Tyrosyl-DNA phosphodiesterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDP1 PE=1 SV=1 86 528 6.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0006281 DNA repair Yes
GO:0008081 phosphoric diester hydrolase activity Yes
GO:0044238 primary metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043226 organelle No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0110165 cellular anatomical entity No
GO:0006259 DNA metabolic process No
GO:0050896 response to stimulus No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0071704 organic substance metabolic process No
GO:0033554 cellular response to stress No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No
GO:0016787 hydrolase activity No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0043227 membrane-bounded organelle No
GO:0051716 cellular response to stimulus No
GO:0006807 nitrogen compound metabolic process No
GO:0042578 phosphoric ester hydrolase activity No
GO:0003824 catalytic activity No
GO:0006974 cellular response to DNA damage stimulus No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006950 response to stress No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2123 0.9267 0.1203 0.0087 0.1526 0.0037 0.0319 0.0341 0.0134 0.0125

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5080
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|997
Ophiocordyceps australis map64 (Brazil) OphauB2|3368
Ophiocordyceps camponoti-floridani Ophcf2|04160
Ophiocordyceps camponoti-rufipedis Ophun1|2080
Ophiocordyceps kimflemingae Ophio5|3018 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2944

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3018
MVTFLSGYRLLRLSYPVLLTQSSVQTSRQKPPFYDPMNNHPLKRQRDHEADSTGPPSKQQRGPATLLASPWQLTR
IRDLPDELNRDAISLRDIVGDTLVRECWHFNFLHDINFLMDVFDPAIRHAVDVHIVHGFWKSDDVRRLVLAQDAT
QFPNVHLHVAPMPEMFGTHHSKMMVLFRRDDTAQVVIHTANMIPKDWTNMTNAVWRSPLLPRLSAAHESSSSVGE
SFKAALLAYLASYDRRGPVCKPLADQLSAYDFSAVRAALVASVPGRHDARARSGPLWGWAALERCLRSVPCKAGD
SEVVVQISSMATLGPRDDWLQKTLFDSLARCKAQQPAARPRFKIVFPTADEVRQSLDGYASGGSIHTKTQSRQQA
SQLEYLRPMLHHWANDCRRGRELPAGSHVLNSGRSRAAPHVKTYMRFSADGSIDWALLSSANLSKQAWGEASKAT
GEMRIASWEVGVMVWPELYGEGSIMVGAFGSDKASERSGGANGAVVGLRMPYSVPLQRYGQNEVPWVASTDHAEP
DCWGRVWEGQSA
Coding >Ophio5|3018
ATGGTCACATTCCTTTCCGGATATCGACTTCTTCGGCTGAGCTATCCCGTGCTCCTCACACAATCGTCTGTTCAA
ACGTCGAGACAAAAGCCTCCTTTCTACGATCCCATGAACAACCACCCGCTCAAGCGGCAGCGGGACCATGAGGCC
GACTCCACAGGTCCACCTTCCAAGCAGCAGCGGGGTCCGGCAACGCTGCTGGCCTCTCCCTGGCAGCTCACGCGC
ATCAGAGACCTCCCTGACGAGCTCAACCGCGATGCCATCTCTCTCCGAGACATCGTGGGCGACACCCTCGTCCGT
GAGTGCTGGCACTTTAACTTTCTCCACGACATCAACTTCCTCATGGACGTCTTCGACCCGGCTATCAGACATGCC
GTCGACGTCCACATCGTTCACGGCTTCTGGAAGTCGGACGACGTCCGCAGGCTGGTCCTTGCCCAAGACGCCACT
CAGTTCCCTAACGTCCATCTGCACGTAGCCCCGATGCCTGAGATGTTCGGCACACACCACTCCAAGATGATGGTA
CTGTTCCGCCGCGACGACACGGCTCAAGTCGTCATCCACACGGCCAACATGATTCCCAAAGACTGGACCAACATG
ACGAATGCCGTTTGGCGCTCGCCGCTGCTGCCGAGGCTGTCGGCTGCGCATGAATCATCATCATCCGTCGGAGAA
AGCTTCAAGGCGGCCCTGCTCGCCTACCTCGCGTCCTACGACCGCCGCGGCCCCGTCTGCAAGCCGCTGGCCGAC
CAACTCTCCGCATACGACTTCTCCGCCGTCAGGGCAGCCTTGGTTGCCAGCGTACCCGGGAGGCACGACGCCCGC
GCCCGGTCGGGGCCACTCTGGGGCTGGGCGGCCCTCGAGAGGTGTCTGAGGTCGGTCCCGTGCAAAGCGGGCGAC
TCGGAAGTCGTTGTCCAGATCTCGTCCATGGCCACGCTCGGTCCCCGGGACGACTGGCTGCAAAAGACATTGTTT
GACTCGCTAGCCAGGTGCAAGGCGCAGCAGCCCGCGGCGAGACCCAGGTTCAAGATCGTCTTCCCCACGGCCGAC
GAGGTTCGGCAGTCTCTCGACGGCTACGCCTCTGGCGGCTCTATACACACCAAAACGCAGTCTCGGCAGCAGGCC
AGCCAGCTCGAATATCTTCGACCCATGCTCCACCACTGGGCCAACGACTGCCGGCGCGGAAGGGAACTGCCGGCG
GGAAGCCATGTGTTAAACAGCGGTCGAAGTCGAGCAGCGCCGCACGTGAAGACGTACATGCGGTTCAGCGCCGAC
GGGTCGATTGACTGGGCACTGCTCAGCTCGGCCAATTTATCGAAACAGGCGTGGGGAGAGGCCAGCAAGGCGACG
GGGGAGATGCGCATAGCGTCGTGGGAGGTTGGAGTGATGGTCTGGCCCGAATTATACGGTGAAGGAAGCATCATG
GTGGGCGCCTTCGGATCCGACAAGGCTTCCGAGAGGAGCGGCGGGGCAAATGGCGCCGTGGTCGGCCTCCGAATG
CCGTATAGCGTGCCGCTGCAGCGATACGGTCAGAACGAGGTGCCGTGGGTAGCGTCAACGGACCACGCCGAGCCC
GACTGCTGGGGCCGCGTCTGGGAGGGCCAAAGCGCA
Transcript >Ophio5|3018
ATGGTCACATTCCTTTCCGGATATCGACTTCTTCGGCTGAGCTATCCCGTGCTCCTCACACAATCGTCTGTTCAA
ACGTCGAGACAAAAGCCTCCTTTCTACGATCCCATGAACAACCACCCGCTCAAGCGGCAGCGGGACCATGAGGCC
GACTCCACAGGTCCACCTTCCAAGCAGCAGCGGGGTCCGGCAACGCTGCTGGCCTCTCCCTGGCAGCTCACGCGC
ATCAGAGACCTCCCTGACGAGCTCAACCGCGATGCCATCTCTCTCCGAGACATCGTGGGCGACACCCTCGTCCGT
GAGTGCTGGCACTTTAACTTTCTCCACGACATCAACTTCCTCATGGACGTCTTCGACCCGGCTATCAGACATGCC
GTCGACGTCCACATCGTTCACGGCTTCTGGAAGTCGGACGACGTCCGCAGGCTGGTCCTTGCCCAAGACGCCACT
CAGTTCCCTAACGTCCATCTGCACGTAGCCCCGATGCCTGAGATGTTCGGCACACACCACTCCAAGATGATGGTA
CTGTTCCGCCGCGACGACACGGCTCAAGTCGTCATCCACACGGCCAACATGATTCCCAAAGACTGGACCAACATG
ACGAATGCCGTTTGGCGCTCGCCGCTGCTGCCGAGGCTGTCGGCTGCGCATGAATCATCATCATCCGTCGGAGAA
AGCTTCAAGGCGGCCCTGCTCGCCTACCTCGCGTCCTACGACCGCCGCGGCCCCGTCTGCAAGCCGCTGGCCGAC
CAACTCTCCGCATACGACTTCTCCGCCGTCAGGGCAGCCTTGGTTGCCAGCGTACCCGGGAGGCACGACGCCCGC
GCCCGGTCGGGGCCACTCTGGGGCTGGGCGGCCCTCGAGAGGTGTCTGAGGTCGGTCCCGTGCAAAGCGGGCGAC
TCGGAAGTCGTTGTCCAGATCTCGTCCATGGCCACGCTCGGTCCCCGGGACGACTGGCTGCAAAAGACATTGTTT
GACTCGCTAGCCAGGTGCAAGGCGCAGCAGCCCGCGGCGAGACCCAGGTTCAAGATCGTCTTCCCCACGGCCGAC
GAGGTTCGGCAGTCTCTCGACGGCTACGCCTCTGGCGGCTCTATACACACCAAAACGCAGTCTCGGCAGCAGGCC
AGCCAGCTCGAATATCTTCGACCCATGCTCCACCACTGGGCCAACGACTGCCGGCGCGGAAGGGAACTGCCGGCG
GGAAGCCATGTGTTAAACAGCGGTCGAAGTCGAGCAGCGCCGCACGTGAAGACGTACATGCGGTTCAGCGCCGAC
GGGTCGATTGACTGGGCACTGCTCAGCTCGGCCAATTTATCGAAACAGGCGTGGGGAGAGGCCAGCAAGGCGACG
GGGGAGATGCGCATAGCGTCGTGGGAGGTTGGAGTGATGGTCTGGCCCGAATTATACGGTGAAGGAAGCATCATG
GTGGGCGCCTTCGGATCCGACAAGGCTTCCGAGAGGAGCGGCGGGGCAAATGGCGCCGTGGTCGGCCTCCGAATG
CCGTATAGCGTGCCGCTGCAGCGATACGGTCAGAACGAGGTGCCGTGGGTAGCGTCAACGGACCACGCCGAGCCC
GACTGCTGGGGCCGCGTCTGGGAGGGCCAAAGCGCATAA
Gene >Ophio5|3018
ATGGTCACATTCCTTTCCGGATATCGACTTCTTCGGCTGAGCTATCCCGTGCTCCTCACACAATCGTCTGTTCAA
ACGTCGAGACAAAAGCCTCCTTTCTACGATCCCATGAACAACCACCCGCTCAAGCGGCAGCGGGACCATGAGGCC
GACTCCACAGGTCCACCTTCCAAGCAGCAGCGGGGTCCGGCAACGCTGCTGGCCTCTCCCTGGCAGCTCACGCGC
ATCAGAGACCTCCCTGACGAGCTCAACCGCGATGCCATCTCTCTCCGAGACATCGTGGGCGACACCCTCGTCCGT
GAGTGCTGGCACTTTAACTTTCTCCACGACATCAACTTCCTCATGGACGTCTTCGACCCGGCTATCAGACATGCC
GTCGACGTCCACATCGTTCACGGCTTCTGGAAGTCGGACGACGTCCGCAGGCTGGTCCTTGCCGTCAGCCAGCAC
CAGCCAGCTTCGGACTTGAGTCTGACGGGCTAACACTGCGCAGCAAGACGCCACTCAGTTCCCTAACGTCCATCT
GCACGTAGCCCCGATGCCTGAGATGTTCGGCACACACCACTCCAAGATGATGGTACTGTTCCGCCGCGACGACAC
GGCTCAAGTCGTCATCCACACGGCCAACATGATTCCCAAAGACTGGACCAACATGACGAATGCCGTTTGGCGCTC
GCCGCTGCTGCCGAGGCTGTCGGCTGCGCATGAATCATCATCATCCGTCGGAGAAAGCTTCAAGGCGGCCCTGCT
CGCCTACCTCGCGTCCTACGACCGCCGCGGCCCCGTCTGCAAGCCGCTGGCCGACCAACTCTCCGCATACGACTT
CTCCGCCGTCAGGGCAGCCTTGGTTGCCAGCGTACCCGGGAGGCACGACGCCCGCGCCCGGTCGGGGCCACTCTG
GGGCTGGGCGGCCCTCGAGAGGTGTCTGAGGTCGGTCCCGTGCAAAGCGGGCGACTCGGAAGTCGTTGTCCAGAT
CTCGTCCATGGCCACGCTCGGTCCCCGGGACGACTGGCTGCAAAAGACATTGTTTGACTCGCTAGCCAGGTGCAA
GGCGCAGCAGCCCGCGGCGAGACCCAGGTTCAAGATCGTCTTCCCCACGGCCGACGAGGTTCGGCAGTCTCTCGA
CGGCTACGCCTCTGGCGGCTCTATACACACCAAAACGCAGTCTCGGCAGCAGGCCAGCCAGCTCGAATATCTTCG
ACCCATGCTCCACCACTGGGCCAACGACTGCCGGCGCGGAAGGGGTAGGGCTCGCTCATGGTGTGGCTGGCTTCG
TTGGACAATGCTGACGGGCGATTGGCAGAACTGCCGGCGGGAAGCCATGTGTTAAACAGCGGTCGAAGTCGAGCA
GCGCCGCACGTGAAGACGTACATGCGGTTCAGCGCCGACGGGTCGATTGACTGGGCACTGCTCAGCTCGGCCAAT
TTATCGAAACAGGCGTGGGGAGAGGCCAGCAAGGCGACGGGGGAGATGCGCATAGCGTCGTGGGAGGTTGGAGTG
ATGGTCTGGCCCGAATTATACGGTGAAGGAAGCATCATGGTGGGCGCCTTCGGATCCGACAAGGCTTCCGAGAGG
AGCGGCGGGGCAAATGGCGCCGTGGTCGGCCTCCGAATGCCGTATAGCGTGCCGCTGCAGCGATACGGTCAGAAC
GAGGTGCCGTGGGTAGCGTCAACGGACCACGCCGAGCCCGACTGCTGGGGCCGCGTCTGGGAGGGCCAAAGCGCA
TAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail