Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3017
Gene name
Locationscaffold_24:52656..54844
Strand-
Gene length (bp)2188
Transcript length (bp)2073
Coding sequence length (bp)2070
Protein length (aa) 690

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 1.7E-14 42 151
PF00085 Thioredoxin Thioredoxin 1.2E-17 233 331

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87178|YB1D_SCHPO Uncharacterized protein C3D6.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.13c PE=1 SV=1 225 644 5.0E-71
sp|Q9P4X1|YKV5_SCHPO Thioredoxin domain-containing protein C959.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC959.05c PE=3 SV=4 246 610 4.0E-36
sp|O74481|YQJ8_SCHPO Uncharacterized protein C1840.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.08c PE=3 SV=1 258 676 7.0E-28
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 41 324 1.0E-21
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 41 324 1.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87178|YB1D_SCHPO Uncharacterized protein C3D6.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.13c PE=1 SV=1 225 644 5.0E-71
sp|Q9P4X1|YKV5_SCHPO Thioredoxin domain-containing protein C959.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC959.05c PE=3 SV=4 246 610 4.0E-36
sp|O74481|YQJ8_SCHPO Uncharacterized protein C1840.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.08c PE=3 SV=1 258 676 7.0E-28
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 41 324 1.0E-21
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 41 324 1.0E-20
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 40 344 6.0E-20
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 40 363 9.0E-19
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 60 415 1.0E-18
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 40 363 1.0E-18
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 60 416 9.0E-18
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 233 411 2.0E-17
sp|P12865|BS2_TRYBB Bloodstream-specific protein 2 OS=Trypanosoma brucei brucei GN=BS2 PE=3 SV=1 229 370 1.0E-13
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 41 320 3.0E-13
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 55 316 4.0E-13
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 55 310 6.0E-13
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 41 331 6.0E-13
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 41 331 6.0E-13
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 251 331 8.0E-13
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 235 450 9.0E-13
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 55 311 1.0E-12
sp|Q8GYD1|PDI51_ARATH Protein disulfide-isomerase 5-1 OS=Arabidopsis thaliana GN=PDIL5-1 PE=2 SV=1 233 349 2.0E-12
sp|Q4N4N8|TXND_THEPA Thioredoxin domain-containing protein OS=Theileria parva GN=TP02_0602 PE=1 SV=1 233 400 3.0E-12
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 55 310 3.0E-12
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 233 331 6.0E-12
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 233 331 7.0E-12
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 233 323 1.0E-11
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 233 323 1.0E-11
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 233 331 2.0E-11
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 233 331 2.0E-11
sp|Q17770|PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1 233 495 2.0E-11
sp|Q00248|PDI_ASPOR Protein disulfide-isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdiA PE=3 SV=1 233 451 3.0E-11
sp|Q10N04|PDI51_ORYSJ Protein disulfide isomerase-like 5-1 OS=Oryza sativa subsp. japonica GN=PDIL5-1 PE=2 SV=1 233 338 4.0E-11
sp|P40557|EPS1_YEAST ER-retained PMA1-suppressing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EPS1 PE=1 SV=1 260 591 6.0E-11
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 227 323 1.0E-10
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 233 344 3.0E-10
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 248 482 5.0E-10
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 248 476 6.0E-10
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 233 505 8.0E-10
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 235 467 9.0E-10
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 229 488 1.0E-09
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 233 366 1.0E-09
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 233 366 2.0E-09
sp|Q12730|PDI_ASPNG Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1 232 451 2.0E-09
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 233 366 3.0E-09
sp|P09102|PDIA1_CHICK Protein disulfide-isomerase OS=Gallus gallus GN=P4HB PE=1 SV=3 214 462 3.0E-09
sp|Q17967|PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1 235 462 4.0E-09
sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens GN=P4HB PE=1 SV=3 253 462 5.0E-09
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 252 462 6.0E-09
sp|Q2HWU2|PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata GN=P4HB PE=2 SV=1 253 462 7.0E-09
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 215 339 1.0E-08
sp|Q5R5B6|PDIA1_PONAB Protein disulfide-isomerase OS=Pongo abelii GN=P4HB PE=2 SV=1 253 462 1.0E-08
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 48 156 1.0E-08
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 223 322 2.0E-08
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 233 322 2.0E-08
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 233 322 2.0E-08
sp|Q96JJ7|TMX3_HUMAN Protein disulfide-isomerase TMX3 OS=Homo sapiens GN=TMX3 PE=1 SV=2 238 362 2.0E-08
sp|P05307|PDIA1_BOVIN Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1 253 462 3.0E-08
sp|Q6GNG3|TMX3_XENLA Protein disulfide-isomerase TMX3 OS=Xenopus laevis GN=tmx3 PE=2 SV=1 223 420 3.0E-08
sp|Q6AX23|QSOX2_XENLA Sulfhydryl oxidase 2 OS=Xenopus laevis GN=qsox2 PE=2 SV=1 235 326 3.0E-08
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 53 156 4.0E-08
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 233 325 6.0E-08
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 233 322 6.0E-08
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 235 333 6.0E-08
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 225 339 6.0E-08
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 253 366 7.0E-08
sp|Q5R875|TMX3_PONAB Protein disulfide-isomerase TMX3 OS=Pongo abelii GN=TMX3 PE=2 SV=1 238 362 7.0E-08
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 223 330 8.0E-08
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 41 164 8.0E-08
sp|P12244|GSBP_CHICK Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2 253 462 9.0E-08
sp|P40557|EPS1_YEAST ER-retained PMA1-suppressing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EPS1 PE=1 SV=1 44 131 1.0E-07
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 224 462 1.0E-07
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 235 311 1.0E-07
sp|Q8BXZ1|TMX3_MOUSE Protein disulfide-isomerase TMX3 OS=Mus musculus GN=Tmx3 PE=1 SV=2 249 362 1.0E-07
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 226 333 2.0E-07
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 226 333 2.0E-07
sp|Q5RDG4|PDIA3_PONAB Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1 233 379 2.0E-07
sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4 233 379 2.0E-07
sp|O08841|QSOX1_CAVPO Sulfhydryl oxidase 1 OS=Cavia porcellus GN=QSOX1 PE=2 SV=2 235 312 2.0E-07
sp|P07591|TRXM_SPIOL Thioredoxin M-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 239 317 2.0E-07
sp|P11598|PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2 233 364 2.0E-07
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 215 339 2.0E-07
sp|H2N4I1|QSOX1_PONAB Sulfhydryl oxidase 1 OS=Pongo abelii GN=QSOX1 PE=3 SV=2 224 312 2.0E-07
sp|Q50KB1|SEP2_EMIHU Protein disulfide-isomerase-like protein EhSep2 OS=Emiliania huxleyi GN=SEP2 PE=1 SV=2 233 335 2.0E-07
sp|P04785|PDIA1_RAT Protein disulfide-isomerase OS=Rattus norvegicus GN=P4hb PE=1 SV=2 253 462 2.0E-07
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 213 357 3.0E-07
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 41 154 3.0E-07
sp|P54399|PDI_DROME Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1 230 328 3.0E-07
sp|Q4VIT4|PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops GN=PDIA3 PE=2 SV=1 233 365 3.0E-07
sp|O00391|QSOX1_HUMAN Sulfhydryl oxidase 1 OS=Homo sapiens GN=QSOX1 PE=1 SV=3 224 312 3.0E-07
sp|P09103|PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus GN=P4hb PE=1 SV=2 253 462 4.0E-07
sp|P33791|THIO_STRAU Thioredoxin (Fragment) OS=Streptomyces aureofaciens GN=trxA PE=3 SV=1 230 314 5.0E-07
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 233 339 5.0E-07
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 48 157 6.0E-07
sp|P48384|TRXM_PEA Thioredoxin M-type, chloroplastic OS=Pisum sativum PE=2 SV=1 239 317 7.0E-07
sp|P27773|PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2 233 364 7.0E-07
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 41 154 8.0E-07
sp|Q6NPF9|TRXY1_ARATH Thioredoxin Y1, chloroplastic OS=Arabidopsis thaliana GN=At1g76760 PE=2 SV=1 236 337 8.0E-07
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 252 416 9.0E-07
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 231 335 9.0E-07
sp|P38657|PDIA3_BOVIN Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1 233 364 9.0E-07
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 229 333 9.0E-07
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 231 364 1.0E-06
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 215 478 1.0E-06
sp|P0A4L2|THIO1_NOSSO Thioredoxin-1 OS=Nostoc sp. (strain ATCC 29151 / PCC 7119) GN=trxA PE=1 SV=2 232 317 1.0E-06
sp|P0A4L1|THIO1_NOSS1 Thioredoxin-1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trxA PE=3 SV=2 232 317 1.0E-06
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 231 333 2.0E-06
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 231 333 2.0E-06
sp|Q17770|PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1 227 332 2.0E-06
sp|Q17967|PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1 41 133 2.0E-06
sp|Q8R4U2|PDIA1_CRIGR Protein disulfide-isomerase OS=Cricetulus griseus GN=P4HB PE=2 SV=1 253 462 2.0E-06
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 226 333 3.0E-06
sp|P29828|PDI_MEDSA Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1 41 135 3.0E-06
sp|Q9SEU6|TRXM4_ARATH Thioredoxin M4, chloroplastic OS=Arabidopsis thaliana GN=At3g15360 PE=2 SV=2 234 317 3.0E-06
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 235 330 4.0E-06
sp|P00275|THIO1_CORNE Thioredoxin C-1 OS=Corynebacterium nephridii PE=1 SV=1 232 314 4.0E-06
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 211 333 6.0E-06
sp|Q4UNK3|THIO_RICFE Thioredoxin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=trxA PE=3 SV=2 234 317 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 632 654 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3017
MRLLALALALGAAAPTWAQTPEDSDPQPESTTFNSVTVPPLLEITPTNWQDEIKKSRWLVVKHYSPYCHHCKDFA
PKYQTLYEYYYTSKTDEGAPLLDSYGLRFAVINCIRYADLCEENNVQRWPTTVVFDKGTRFEAIEGNQKIPAVSK
LIESALEKEKPGSRPKELALPEPGAKESPPSKAADKVDGKEKPDNKADGNGKPADSAKGKPDKVSETAVDKPLAT
TNPTGVSVSLTAESFQKMVTMTQDPWFIKLYSPRCHHCQALAPTWGQLAKSMRGKLQIGEVNCEREPALCRKDLN
VKLYPTIVFFKGGERTDYSGLRGLGDFVQYAEEAMELARGVPDVDADELKKLEQKHDVIFIYFYDHATTSEDFKA
LERLPLSLIGHAKLVKTKDRKLYDRFKITTWPRLLVSREGRPTYYPPLTPDEMRDVRGVLDWMKSVWLPLVPELS
PSNARQIMDGKLVVLGIVNHDDHDAFQASLREMKSAANEWMDRQLQEFQLERKKLRDSKQMRIEEAEDRNDQRAL
RAAKAIRVNMDNSGRKEVMFAWVDGVYWQRWIRTTYGIDVKDGERIIINDEDNRRYWDQTVTGNHMLVSRTSIME
TLDKIVYGPNVIKPKLTISAPEKMLLDIRVALMEHPLLTLGCVVGIGFGVISWIRGRNRRRGGHFRLDDTMGIKE
LKDGLLGVNGNHKAD
Coding >Ophio5|3017
ATGAGGCTGCTCGCCCTCGCCCTGGCTCTCGGGGCCGCCGCCCCTACCTGGGCGCAGACGCCGGAAGACAGCGAC
CCCCAGCCCGAGAGCACCACCTTTAACTCCGTCACCGTCCCTCCGCTACTCGAGATCACGCCCACCAACTGGCAA
GATGAGATCAAGAAGTCGCGATGGCTCGTCGTCAAGCATTACAGCCCCTATTGCCACCACTGCAAAGACTTTGCC
CCCAAGTATCAAACTCTGTACGAGTATTACTACACGTCCAAGACCGACGAAGGCGCTCCCCTTTTGGATTCCTAC
GGCCTCCGGTTCGCCGTCATCAACTGCATCCGTTATGCTGATCTTTGCGAGGAAAATAATGTCCAACGCTGGCCC
ACCACCGTCGTCTTCGACAAGGGCACCAGGTTCGAGGCCATCGAAGGGAACCAAAAGATACCCGCCGTCAGCAAA
CTCATCGAAAGTGCGCTGGAAAAGGAAAAACCTGGTTCGCGACCCAAAGAACTCGCCCTGCCTGAGCCTGGCGCC
AAAGAATCGCCGCCAAGCAAAGCCGCAGACAAGGTCGATGGCAAGGAAAAGCCGGACAATAAGGCCGACGGCAAC
GGAAAACCGGCCGACTCGGCCAAGGGCAAGCCCGACAAGGTCTCCGAGACGGCTGTCGACAAGCCCCTGGCGACG
ACCAACCCCACCGGTGTCTCCGTCTCCCTGACGGCGGAGAGCTTCCAGAAGATGGTGACGATGACGCAGGATCCG
TGGTTCATCAAGCTGTACTCCCCCCGGTGCCACCATTGTCAAGCCCTGGCGCCGACGTGGGGGCAGCTGGCCAAG
TCGATGCGGGGCAAGCTTCAAATCGGCGAGGTTAACTGCGAAAGGGAGCCTGCGCTGTGCAGAAAGGATCTCAAC
GTCAAGCTCTACCCCACCATCGTGTTCTTCAAGGGCGGCGAGCGGACCGATTACAGTGGCCTCCGAGGCCTGGGC
GACTTTGTGCAGTACGCGGAAGAGGCCATGGAGCTGGCCCGTGGCGTCCCCGACGTCGACGCCGACGAGCTGAAG
AAGCTGGAGCAGAAGCACGACGTAATCTTCATTTACTTTTACGACCACGCCACGACGAGCGAGGATTTTAAGGCG
CTCGAGAGGCTACCGCTGAGCCTGATTGGCCACGCCAAGCTGGTCAAGACGAAGGACCGCAAGCTCTATGACCGG
TTCAAGATTACGACGTGGCCGAGGCTCCTCGTGTCCAGGGAAGGCCGGCCGACGTACTACCCGCCACTGACTCCG
GACGAGATGCGCGACGTGCGTGGTGTGCTCGACTGGATGAAGTCGGTGTGGCTGCCGCTCGTGCCCGAGCTGTCG
CCGTCCAACGCGCGGCAAATCATGGACGGCAAGCTCGTGGTGCTGGGCATCGTCAACCACGACGACCACGACGCC
TTCCAGGCCTCCCTGCGCGAGATGAAGAGCGCGGCCAACGAGTGGATGGACCGGCAGCTGCAGGAGTTTCAGCTG
GAGCGGAAGAAGCTGCGCGACTCCAAGCAGATGAGGATCGAGGAGGCCGAGGACCGAAACGATCAAAGGGCACTT
AGGGCGGCCAAGGCAATCCGGGTCAATATGGACAACTCGGGTCGCAAGGAGGTCATGTTCGCATGGGTCGACGGC
GTCTACTGGCAACGATGGATCCGCACCACGTACGGCATCGACGTCAAAGACGGCGAGCGCATCATCATCAACGAC
GAAGACAACCGGAGGTACTGGGACCAGACGGTGACGGGTAACCACATGCTCGTGTCGCGCACGTCGATAATGGAG
ACGTTGGATAAGATTGTGTACGGGCCCAACGTGATCAAGCCGAAGCTGACCATCTCGGCGCCGGAGAAGATGCTA
CTGGACATTCGCGTTGCGTTGATGGAGCATCCGCTGCTGACGCTCGGCTGCGTTGTCGGCATCGGCTTCGGCGTC
ATCTCCTGGATCCGCGGGCGCAATCGCAGACGCGGCGGACACTTTCGACTGGACGACACTATGGGCATCAAGGAG
CTCAAGGACGGGCTGTTGGGGGTCAATGGCAATCACAAGGCTGAC
Transcript >Ophio5|3017
ATGAGGCTGCTCGCCCTCGCCCTGGCTCTCGGGGCCGCCGCCCCTACCTGGGCGCAGACGCCGGAAGACAGCGAC
CCCCAGCCCGAGAGCACCACCTTTAACTCCGTCACCGTCCCTCCGCTACTCGAGATCACGCCCACCAACTGGCAA
GATGAGATCAAGAAGTCGCGATGGCTCGTCGTCAAGCATTACAGCCCCTATTGCCACCACTGCAAAGACTTTGCC
CCCAAGTATCAAACTCTGTACGAGTATTACTACACGTCCAAGACCGACGAAGGCGCTCCCCTTTTGGATTCCTAC
GGCCTCCGGTTCGCCGTCATCAACTGCATCCGTTATGCTGATCTTTGCGAGGAAAATAATGTCCAACGCTGGCCC
ACCACCGTCGTCTTCGACAAGGGCACCAGGTTCGAGGCCATCGAAGGGAACCAAAAGATACCCGCCGTCAGCAAA
CTCATCGAAAGTGCGCTGGAAAAGGAAAAACCTGGTTCGCGACCCAAAGAACTCGCCCTGCCTGAGCCTGGCGCC
AAAGAATCGCCGCCAAGCAAAGCCGCAGACAAGGTCGATGGCAAGGAAAAGCCGGACAATAAGGCCGACGGCAAC
GGAAAACCGGCCGACTCGGCCAAGGGCAAGCCCGACAAGGTCTCCGAGACGGCTGTCGACAAGCCCCTGGCGACG
ACCAACCCCACCGGTGTCTCCGTCTCCCTGACGGCGGAGAGCTTCCAGAAGATGGTGACGATGACGCAGGATCCG
TGGTTCATCAAGCTGTACTCCCCCCGGTGCCACCATTGTCAAGCCCTGGCGCCGACGTGGGGGCAGCTGGCCAAG
TCGATGCGGGGCAAGCTTCAAATCGGCGAGGTTAACTGCGAAAGGGAGCCTGCGCTGTGCAGAAAGGATCTCAAC
GTCAAGCTCTACCCCACCATCGTGTTCTTCAAGGGCGGCGAGCGGACCGATTACAGTGGCCTCCGAGGCCTGGGC
GACTTTGTGCAGTACGCGGAAGAGGCCATGGAGCTGGCCCGTGGCGTCCCCGACGTCGACGCCGACGAGCTGAAG
AAGCTGGAGCAGAAGCACGACGTAATCTTCATTTACTTTTACGACCACGCCACGACGAGCGAGGATTTTAAGGCG
CTCGAGAGGCTACCGCTGAGCCTGATTGGCCACGCCAAGCTGGTCAAGACGAAGGACCGCAAGCTCTATGACCGG
TTCAAGATTACGACGTGGCCGAGGCTCCTCGTGTCCAGGGAAGGCCGGCCGACGTACTACCCGCCACTGACTCCG
GACGAGATGCGCGACGTGCGTGGTGTGCTCGACTGGATGAAGTCGGTGTGGCTGCCGCTCGTGCCCGAGCTGTCG
CCGTCCAACGCGCGGCAAATCATGGACGGCAAGCTCGTGGTGCTGGGCATCGTCAACCACGACGACCACGACGCC
TTCCAGGCCTCCCTGCGCGAGATGAAGAGCGCGGCCAACGAGTGGATGGACCGGCAGCTGCAGGAGTTTCAGCTG
GAGCGGAAGAAGCTGCGCGACTCCAAGCAGATGAGGATCGAGGAGGCCGAGGACCGAAACGATCAAAGGGCACTT
AGGGCGGCCAAGGCAATCCGGGTCAATATGGACAACTCGGGTCGCAAGGAGGTCATGTTCGCATGGGTCGACGGC
GTCTACTGGCAACGATGGATCCGCACCACGTACGGCATCGACGTCAAAGACGGCGAGCGCATCATCATCAACGAC
GAAGACAACCGGAGGTACTGGGACCAGACGGTGACGGGTAACCACATGCTCGTGTCGCGCACGTCGATAATGGAG
ACGTTGGATAAGATTGTGTACGGGCCCAACGTGATCAAGCCGAAGCTGACCATCTCGGCGCCGGAGAAGATGCTA
CTGGACATTCGCGTTGCGTTGATGGAGCATCCGCTGCTGACGCTCGGCTGCGTTGTCGGCATCGGCTTCGGCGTC
ATCTCCTGGATCCGCGGGCGCAATCGCAGACGCGGCGGACACTTTCGACTGGACGACACTATGGGCATCAAGGAG
CTCAAGGACGGGCTGTTGGGGGTCAATGGCAATCACAAGGCTGACTAG
Gene >Ophio5|3017
ATGAGGCTGCTCGCCCTCGCCCTGGCTCTCGGGGCCGCCGCCCCTACCTGGGCGCAGACGCCGGAAGACAGCGAC
CCCCAGCCCGAGAGCACCACCTTTAACTCCGTCACCGTCCCTCCGCTACTCGAGATCACGCCCACCAACTGGCAA
GATGAGATCAAGAAGTCGCGATGGCTCGTCGTCAAGCATTACAGGTAAGCTCGGCATACCCATCTCCCGCCGTCG
CACCCGCCGCTGACTTGCCCTCGGACAGCCCCTATTGCCACCACTGCAAAGACTTTGCCCCCAAGTATCAAACTC
TGTACGAGTATTACTACACGTCCAAGACCGACGAAGGCGCTCCCCTTTTGGATTCCTACGGCCTCCGGTTCGCCG
TCATCAACTGCATCCGTTATGCTGATCTTTGCGAGGAAAATAATGTCCAACGCTGGCCCACCACCGTCGTCTTCG
ACAAGGGCACCAGGTTCGAGGCCATCGAAGGGAACCAAAAGATACCCGCCGTCAGCAAACTCATCGAAAGTGCGC
TGGAAAAGGAAAAACCTGGTTCGCGACCCAAAGAACTCGCCCTGCCTGAGCCTGGCGCCAAAGAATCGCCGCCAA
GCAAAGCCGCAGACAAGGTCGATGGCAAGGAAAAGCCGGACAATAAGGCCGACGGCAACGGAAAACCGGCCGACT
CGGCCAAGGGCAAGCCCGACAAGGTCTCCGAGACGGCTGTCGACAAGCCCCTGGCGACGACCAACCCCACCGGTG
TCTCCGTCTCCCTGACGGCGGAGAGCTTCCAGAAGATGGTGACGATGACGCAGGATCCGTGGTTCATCAAGCTGT
ACTCCCCCCGGTGCCACCATTGTCAAGCCCTGGCGCCGACGTGGGGGCAGCTGGCCAAGTCGATGCGGGGCAAGC
TTCAAATCGGCGAGGTTAACTGCGAAAGGGAGCCTGCGCTGTGCAGAAAGGATCTCAACGTCAAGCTCTACCCCA
CCATCGTGTTCTTCAAGGGCGGCGAGCGGACCGATTACAGTGGCCTCCGAGGCCTGGGCGACTTTGTGCAGTACG
CGGAAGAGGCCATGGAGCTGGCCCGTGGCGTCCCCGACGTCGACGCCGACGAGCTGAAGAAGCTGGAGCAGAAGC
ACGACGTAATCTTCATTTACTTTTACGACCACGCCACGACGAGCGAGGATTTTAAGGCGCTCGAGAGGCTACCGC
TGAGCCTGATTGGCCACGCCAAGCTGGTCAAGACGAAGGACCGCAAGCTCTATGACCGGTTCAAGATTACGACGT
GGCCGAGGCTCCTCGTGTCCAGGGAAGGCCGGCCGACGTACTACCCGCCACTGACTCCGGACGAGATGCGCGACG
TGCGTGGTGTGCTCGACTGGATGAAGTCGGTGTGGCTGCCGCTCGTGCCCGAGCTGTCGCCGTCCAACGCGCGGC
AAATCATGGACGGCAAGCTCGTGGTGCTGGGCATCGTCAACCACGACGACCACGACGCCTTCCAGGCCTCCCTGC
GCGAGATGAAGAGCGCGGCCAACGAGTGGATGGACCGGCAGCTGCAGGAGTTTCAGCTGGAGCGGAAGAAGCTGC
GCGACTCCAAGCAGATGAGGATCGAGGAGGCCGAGGACCGAAACGATCAAAGGGCACTTAGGGCGGCCAAGGCAA
TCCGGGTCAATATGGACAACTCGGGTCGCAAGGAGGTCATGTTCGCATGGGTCGACGGCGTCTACTGGCAACGAT
GGATCCGCACCACGTACGGCATCGACGTCAAAGACGGCGAGCGCATCATCATCAACGACGAAGACGTGAGTTCTT
GACCCTCCCTCACATGCATGTGGACGTCTGCTAACGGTGCGGACAGAACCGGAGGTACTGGGACCAGACGGTGAC
GGGTAACCACATGCTCGTGTCGCGCACGTCGATAATGGAGACGTTGGATAAGATTGTGTACGGGCCCAACGTGAT
CAAGCCGAAGCTGACCATCTCGGCGCCGGAGAAGATGCTACTGGACATTCGCGTTGCGTTGATGGAGCATCCGCT
GCTGACGCTCGGCTGCGTTGTCGGCATCGGCTTCGGCGTCATCTCCTGGATCCGCGGGCGCAATCGCAGACGCGG
CGGACACTTTCGACTGGACGACACTATGGGCATCAAGGAGCTCAAGGACGGGCTGTTGGGGGTCAATGGCAATCA
CAAGGCTGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail