Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3013
Gene name
Locationscaffold_24:45658..47847
Strand-
Gene length (bp)2189
Transcript length (bp)1989
Coding sequence length (bp)1986
Protein length (aa) 662

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00271 Helicase_C Helicase conserved C-terminal domain 4.9E-14 240 339
PF04851 ResIII Type III restriction enzyme, res subunit 1.4E-13 41 122
PF00270 DEAD DEAD/DEAH box helicase 3.8E-06 44 115

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06683|IRC3_YEAST Putative ATP-dependent helicase IRC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC3 PE=1 SV=1 40 432 1.0E-85
sp|Q1MTR1|IRC3_SCHPO Putative mitochondrial ATP-dependent helicase irc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=irc3 PE=3 SV=2 27 644 1.0E-77
sp|P33919|YEJH_ECOLI Uncharacterized protein YejH OS=Escherichia coli (strain K12) GN=yejH PE=3 SV=2 42 354 1.0E-21
sp|P24125|V51K_BPL79 51.5 kDa protein OS=Lactococcus phage (isolate 7-9) PE=3 SV=1 71 338 2.0E-11
sp|Q914K8|Y022_SIFVH Putative helicase 22 OS=Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) GN=SIFV0022 PE=3 SV=1 150 352 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06683|IRC3_YEAST Putative ATP-dependent helicase IRC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC3 PE=1 SV=1 40 432 1.0E-85
sp|Q1MTR1|IRC3_SCHPO Putative mitochondrial ATP-dependent helicase irc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=irc3 PE=3 SV=2 27 644 1.0E-77
sp|P33919|YEJH_ECOLI Uncharacterized protein YejH OS=Escherichia coli (strain K12) GN=yejH PE=3 SV=2 42 354 1.0E-21
sp|P24125|V51K_BPL79 51.5 kDa protein OS=Lactococcus phage (isolate 7-9) PE=3 SV=1 71 338 2.0E-11
sp|Q914K8|Y022_SIFVH Putative helicase 22 OS=Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) GN=SIFV0022 PE=3 SV=1 150 352 2.0E-10
sp|P08956|T1RK_ECOLI Type I restriction enzyme EcoKI R protein OS=Escherichia coli (strain K12) GN=hsdR PE=3 SV=3 214 357 2.0E-09
sp|Q5E6B5|UVRB_VIBF1 UvrABC system protein B OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=uvrB PE=3 SV=1 230 411 1.0E-07
sp|P45125|UVRB_HAEIN UvrABC system protein B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=uvrB PE=3 SV=1 241 415 3.0E-07
sp|Q4QJX4|UVRB_HAEI8 UvrABC system protein B OS=Haemophilus influenzae (strain 86-028NP) GN=uvrB PE=3 SV=1 241 362 3.0E-07
sp|Q7NJH7|UVRB_GLOVI UvrABC system protein B OS=Gloeobacter violaceus (strain PCC 7421) GN=uvrB PE=3 SV=1 241 362 6.0E-07
sp|P57844|UVRB_PASMU UvrABC system protein B OS=Pasteurella multocida (strain Pm70) GN=uvrB PE=3 SV=1 241 362 7.0E-07
sp|Q65ST2|UVRB_MANSM UvrABC system protein B OS=Mannheimia succiniciproducens (strain MBEL55E) GN=uvrB PE=3 SV=1 241 362 7.0E-07
sp|B6EGH8|UVRB_ALISL UvrABC system protein B OS=Aliivibrio salmonicida (strain LFI1238) GN=uvrB PE=3 SV=1 230 411 7.0E-07
sp|Q8DHC6|UVRB_THEEB UvrABC system protein B OS=Thermosynechococcus elongatus (strain BP-1) GN=uvrB PE=3 SV=1 261 362 2.0E-06
sp|Q31ES7|UVRB_THICR UvrABC system protein B OS=Thiomicrospira crunogena (strain XCL-2) GN=uvrB PE=3 SV=1 233 359 2.0E-06
sp|Q87MX6|UVRB_VIBPA UvrABC system protein B OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=uvrB PE=3 SV=1 241 359 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:0003677 DNA binding Yes
GO:0016787 hydrolase activity Yes
GO:0017076 purine nucleotide binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:0030554 adenyl nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0035639 purine ribonucleoside triphosphate binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1191 0.1529 0.1151 0.077 0.845 0.0469 0.027 0.0496 0.0652 0.011

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2520
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4430
Ophiocordyceps australis map64 (Brazil) OphauB2|1165
Ophiocordyceps camponoti-floridani Ophcf2|04156
Ophiocordyceps camponoti-rufipedis Ophun1|2157
Ophiocordyceps kimflemingae Ophio5|3013 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3685

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3013
MLRFASGYIFRPGLALGFRVPRLLNIPRAGAATLASDDKPQLRDYQLECIDSVLSSLDKGHKRVGISLATGSGKT
VVFTQLIDKIKPRPNDGDRTLILAHRRELVEQAAHGLSACLGRGRHHRRQRSEHHVQGPARKALKHFGLGHKQQD
SPTLIGVSATFSRFDGLKLGVAIDEIVFHRDYVDMISDNWLSNVIFTTVRSSANLSQVKRGVFGDFHTGELSQAV
NTHEVNELTVRSWMTKASDRKSTLVFCVDLAHVSGLTHAFRQHQIDARFVTGDTPKVERSETLDAFKRGDFPILV
NCGVFTEGTDIPNVDCIVLARPTRSRNLLVQMIGRGMRLHPGKDDCHVIDLVSSLETGIITTPTLFGLDPSELVD
KASVGDLRVIKERKSAEEDRARQAYREGEQPSAVTPGPASVTFTDYASVFDLIADTNKDKYIRTISPYCWVRTGE
HRHVLVSSNGDFLRIERVEPDVEEEEADETDETDAVPPSSDEDDGLQQTAEEGETSGSTADDAEQGTRRTGQTAH
YRTVLIRSLRFMKTKAPYSAPHEILKAATFADAVHGSDSYASKAFPHVYISLNQPWRKQRATPAQVNFLNRFRSA
DDQLRPEDISKGKAMDMMTKFKHGARGEFRRIKGQQRKLDRKAHAEAQRKARERVQVGPVQR
Coding >Ophio5|3013
ATGCTGCGCTTCGCTTCCGGATACATCTTTCGCCCGGGCCTCGCCCTGGGCTTCCGAGTGCCTCGATTATTAAAT
ATTCCCAGAGCCGGCGCGGCGACACTCGCTTCCGACGATAAGCCCCAGCTCAGGGACTACCAGCTGGAATGCATC
GACTCGGTGCTCTCGTCGCTCGACAAGGGACATAAACGCGTCGGTATCTCGCTCGCCACGGGCAGCGGCAAGACG
GTCGTCTTCACCCAGCTCATCGACAAGATCAAGCCGAGGCCCAATGACGGCGATCGAACCCTCATTCTGGCTCAT
CGCCGCGAACTCGTCGAGCAGGCTGCGCATGGGCTCTCTGCATGCCTCGGGCGCGGCCGACATCACCGTCGCCAG
CGTTCAGAGCATCACGTCCAAGGACCGGCTCGAAAAGCGCTCAAACATTTCGGCCTCGGCCATAAGCAGCAAGAC
TCGCCCACCCTCATCGGCGTCTCCGCTACCTTCTCCCGCTTCGACGGCCTCAAGCTAGGCGTCGCCATTGACGAG
ATCGTCTTTCACAGGGACTACGTCGACATGATCTCCGACAATTGGCTCTCCAACGTCATCTTCACCACCGTCCGG
TCGTCGGCCAACCTGTCGCAGGTGAAGAGGGGCGTCTTCGGAGACTTCCACACCGGGGAACTGTCCCAGGCGGTC
AATACACACGAGGTCAATGAGCTGACGGTCCGCAGCTGGATGACCAAGGCCTCGGACAGGAAGTCGACGCTCGTC
TTCTGCGTCGACCTGGCCCACGTCAGCGGCCTGACCCACGCCTTTCGCCAGCACCAGATCGACGCCCGCTTCGTG
ACGGGAGATACGCCCAAGGTGGAGCGCAGCGAGACGCTCGACGCCTTCAAGAGGGGCGACTTCCCCATCCTCGTC
AACTGCGGCGTCTTCACCGAGGGCACCGACATCCCCAACGTCGACTGTATCGTCCTCGCCAGGCCGACTCGTTCT
CGCAATCTCCTCGTCCAGATGATTGGCAGGGGTATGCGCCTGCATCCGGGCAAGGATGACTGCCACGTCATTGAT
CTGGTCTCGAGTCTCGAGACTGGAATCATCACGACGCCCACCCTCTTCGGGCTCGATCCCAGCGAGCTAGTCGAC
AAGGCTTCCGTCGGCGACTTGCGGGTCATAAAGGAACGCAAGAGCGCCGAGGAAGACCGGGCGCGGCAGGCGTAC
CGGGAGGGAGAGCAGCCGTCGGCCGTGACGCCCGGGCCGGCATCCGTCACCTTCACCGACTACGCCTCCGTCTTC
GACCTCATCGCCGACACGAACAAGGACAAGTACATACGCACCATCAGCCCGTATTGCTGGGTCCGCACCGGCGAG
CATCGCCACGTGCTCGTCTCCTCCAACGGCGACTTTCTGCGCATCGAGCGTGTCGAGCCAGATGTCGAGGAGGAG
GAGGCGGACGAGACGGACGAGACGGACGCTGTCCCCCCCTCATCCGACGAGGACGACGGTCTCCAGCAGACAGCC
GAGGAGGGCGAGACTTCCGGCTCTACGGCCGATGATGCGGAGCAGGGGACGAGAAGGACGGGGCAGACGGCCCAC
TACCGGACCGTCCTCATCCGCAGCCTCCGATTCATGAAGACCAAGGCCCCCTACTCGGCGCCGCACGAGATCCTC
AAGGCGGCGACGTTCGCCGACGCCGTGCACGGCTCCGACAGCTACGCCTCCAAGGCCTTCCCGCACGTCTACATC
AGCCTCAACCAGCCGTGGCGCAAGCAGCGGGCGACTCCGGCCCAGGTCAACTTCCTCAACCGCTTCCGCTCCGCC
GACGACCAGCTCCGGCCCGAGGACATATCCAAGGGCAAGGCCATGGACATGATGACCAAGTTCAAGCACGGCGCC
CGTGGCGAGTTTCGTCGCATCAAGGGACAGCAGAGGAAGTTGGATAGGAAGGCTCATGCTGAGGCTCAGCGCAAG
GCTCGTGAGCGCGTTCAAGTCGGCCCTGTTCAGCGC
Transcript >Ophio5|3013
ATGCTGCGCTTCGCTTCCGGATACATCTTTCGCCCGGGCCTCGCCCTGGGCTTCCGAGTGCCTCGATTATTAAAT
ATTCCCAGAGCCGGCGCGGCGACACTCGCTTCCGACGATAAGCCCCAGCTCAGGGACTACCAGCTGGAATGCATC
GACTCGGTGCTCTCGTCGCTCGACAAGGGACATAAACGCGTCGGTATCTCGCTCGCCACGGGCAGCGGCAAGACG
GTCGTCTTCACCCAGCTCATCGACAAGATCAAGCCGAGGCCCAATGACGGCGATCGAACCCTCATTCTGGCTCAT
CGCCGCGAACTCGTCGAGCAGGCTGCGCATGGGCTCTCTGCATGCCTCGGGCGCGGCCGACATCACCGTCGCCAG
CGTTCAGAGCATCACGTCCAAGGACCGGCTCGAAAAGCGCTCAAACATTTCGGCCTCGGCCATAAGCAGCAAGAC
TCGCCCACCCTCATCGGCGTCTCCGCTACCTTCTCCCGCTTCGACGGCCTCAAGCTAGGCGTCGCCATTGACGAG
ATCGTCTTTCACAGGGACTACGTCGACATGATCTCCGACAATTGGCTCTCCAACGTCATCTTCACCACCGTCCGG
TCGTCGGCCAACCTGTCGCAGGTGAAGAGGGGCGTCTTCGGAGACTTCCACACCGGGGAACTGTCCCAGGCGGTC
AATACACACGAGGTCAATGAGCTGACGGTCCGCAGCTGGATGACCAAGGCCTCGGACAGGAAGTCGACGCTCGTC
TTCTGCGTCGACCTGGCCCACGTCAGCGGCCTGACCCACGCCTTTCGCCAGCACCAGATCGACGCCCGCTTCGTG
ACGGGAGATACGCCCAAGGTGGAGCGCAGCGAGACGCTCGACGCCTTCAAGAGGGGCGACTTCCCCATCCTCGTC
AACTGCGGCGTCTTCACCGAGGGCACCGACATCCCCAACGTCGACTGTATCGTCCTCGCCAGGCCGACTCGTTCT
CGCAATCTCCTCGTCCAGATGATTGGCAGGGGTATGCGCCTGCATCCGGGCAAGGATGACTGCCACGTCATTGAT
CTGGTCTCGAGTCTCGAGACTGGAATCATCACGACGCCCACCCTCTTCGGGCTCGATCCCAGCGAGCTAGTCGAC
AAGGCTTCCGTCGGCGACTTGCGGGTCATAAAGGAACGCAAGAGCGCCGAGGAAGACCGGGCGCGGCAGGCGTAC
CGGGAGGGAGAGCAGCCGTCGGCCGTGACGCCCGGGCCGGCATCCGTCACCTTCACCGACTACGCCTCCGTCTTC
GACCTCATCGCCGACACGAACAAGGACAAGTACATACGCACCATCAGCCCGTATTGCTGGGTCCGCACCGGCGAG
CATCGCCACGTGCTCGTCTCCTCCAACGGCGACTTTCTGCGCATCGAGCGTGTCGAGCCAGATGTCGAGGAGGAG
GAGGCGGACGAGACGGACGAGACGGACGCTGTCCCCCCCTCATCCGACGAGGACGACGGTCTCCAGCAGACAGCC
GAGGAGGGCGAGACTTCCGGCTCTACGGCCGATGATGCGGAGCAGGGGACGAGAAGGACGGGGCAGACGGCCCAC
TACCGGACCGTCCTCATCCGCAGCCTCCGATTCATGAAGACCAAGGCCCCCTACTCGGCGCCGCACGAGATCCTC
AAGGCGGCGACGTTCGCCGACGCCGTGCACGGCTCCGACAGCTACGCCTCCAAGGCCTTCCCGCACGTCTACATC
AGCCTCAACCAGCCGTGGCGCAAGCAGCGGGCGACTCCGGCCCAGGTCAACTTCCTCAACCGCTTCCGCTCCGCC
GACGACCAGCTCCGGCCCGAGGACATATCCAAGGGCAAGGCCATGGACATGATGACCAAGTTCAAGCACGGCGCC
CGTGGCGAGTTTCGTCGCATCAAGGGACAGCAGAGGAAGTTGGATAGGAAGGCTCATGCTGAGGCTCAGCGCAAG
GCTCGTGAGCGCGTTCAAGTCGGCCCTGTTCAGCGCTAG
Gene >Ophio5|3013
ATGCTGCGCTTCGCTTCCGGATACATCTTTCGCCCGGGCCTCGCCCTGGGCTTCCGAGTGCCTCGATTATTAAAT
ATTCCCAGAGCCGGCGCGGCGACACTCGCTTCCGACGATAAGCCCCAGCTCAGGGACTACCAGCTGGAATGCATC
GACTCGGTGCTCTCGTCGCTCGACAAGGGACATAAACGCGTCGGTATCTCGCTCGCCACGGGCAGCGGCAAGACG
GTACAATTGCTTCTTCTTCTTATAGCACATTTATCTATCTGTATTGACCGCCCGTACCCCCTCCCCCCCTTCCCC
CCTTCCAGGTCGTCTTCACCCAGCTCATCGACAAGATCAAGCCGAGGCCCAATGACGGCGATCGAACCCTCATTC
TGGCTCATCGCCGCGAACTCGTCGAGCAGGCTGCGCGTCATTGCCTTCGCGCCTATCCAGACAAGTCGATTGAGA
TCGAGATGGGCTCTCTGCATGCCTCGGGCGCGGCCGACATCACCGTCGCCAGCGTTCAGAGCATCACGTCCAAGG
ACCGGCTCGAAAAGTTTGTCCCTTCGGCTTTCAAGCTGGTGCTCGTCGACGAGGCTCATCACATAGTCTCTCCCG
GCTATCTCAAGGCGCTCAAACATTTCGGCCTCGGCCATAAGCAGCAAGACTCGCCCACCCTCATCGGCGTCTCCG
CTACCTTCTCCCGCTTCGACGGCCTCAAGCTAGGCGTCGCCATTGACGAGATCGTCTTTCACAGGGACTACGTCG
ACATGATCTCCGACAATTGGCTCTCCAACGTCATCTTCACCACCGTCCGGTCGTCGGCCAACCTGTCGCAGGTGA
AGAGGGGCGTCTTCGGAGACTTCCACACCGGGGAACTGTCCCAGGCGGTCAATACACACGAGGTCAATGAGCTGA
CGGTCCGCAGCTGGATGACCAAGGCCTCGGACAGGAAGTCGACGCTCGTCTTCTGCGTCGACCTGGCCCACGTCA
GCGGCCTGACCCACGCCTTTCGCCAGCACCAGATCGACGCCCGCTTCGTGACGGGAGATACGCCCAAGGTGGAGC
GCAGCGAGACGCTCGACGCCTTCAAGAGGGGCGACTTCCCCATCCTCGTCAACTGCGGCGTCTTCACCGAGGGCA
CCGACATCCCCAACGTCGACTGTATCGTCCTCGCCAGGCCGACTCGTTCTCGCAATCTCCTCGTCCAGATGATTG
GCAGGGGTATGCGCCTGCATCCGGGCAAGGATGACTGCCACGTCATTGATCTGGTCTCGAGTCTCGAGACTGGAA
TCATCACGACGCCCACCCTCTTCGGGCTCGATCCCAGCGAGCTAGTCGACAAGGCTTCCGTCGGCGACTTGCGGG
TCATAAAGGAACGCAAGAGCGCCGAGGAAGACCGGGCGCGGCAGGCGTACCGGGAGGGAGAGCAGCCGTCGGCCG
TGACGCCCGGGCCGGCATCCGTCACCTTCACCGACTACGCCTCCGTCTTCGACCTCATCGCCGACACGAACAAGG
ACAAGTACATACGCACCATCAGCCCGTATTGCTGGGTCCGCACCGGCGAGCATCGCCACGTGCTCGTCTCCTCCA
ACGGCGACTTTCTGCGCATCGAGCGTGTCGAGCCAGATGTCGAGGAGGAGGAGGCGGACGAGACGGACGAGACGG
ACGCTGTCCCCCCCTCATCCGACGAGGACGACGGTCTCCAGCAGACAGCCGAGGAGGGCGAGACTTCCGGCTCTA
CGGCCGATGATGCGGAGCAGGGGACGAGAAGGACGGGGCAGACGGCCCACTACCGGACCGTCCTCATCCGCAGCC
TCCGATTCATGAAGACCAAGGCCCCCTACTCGGCGCCGCACGAGATCCTCAAGGCGGCGACGTTCGCCGACGCCG
TGCACGGCTCCGACAGCTACGCCTCCAAGGCCTTCCCGCACGTCTACATCAGCCTCAACCAGCCGTGGCGCAAGC
AGCGGGCGACTCCGGCCCAGGTCAACTTCCTCAACCGCTTCCGCTCCGCCGACGACCAGCTCCGGCCCGAGGACA
TATCCAAGGGCAAGGCCATGGACATGATGACCAAGTTCAAGCACGGCGCCCGTGGCGAGTTTCGTCGCATCAAGG
GACAGCAGAGGAAGTTGGATAGGAAGGCTCATGCTGAGGCTCAGCGCAAGGCTCGTGAGCGCGTTCAAGTCGGCC
CTGTTCAGCGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail