Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3008
Gene name
Locationscaffold_24:32472..33774
Strand-
Gene length (bp)1302
Transcript length (bp)1173
Coding sequence length (bp)1170
Protein length (aa) 390

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03839 Sec62 Translocation protein Sec62 9.4E-63 132 318

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99161|SEC62_YARLI Translocation protein SEC62 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC62 PE=3 SV=2 104 326 2.0E-60
sp|O13787|SEC62_SCHPO Translocation protein sec62 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec62 PE=3 SV=1 107 388 1.0E-53
sp|Q5AI21|SEC62_CANAL Translocation protein SEC62 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC62 PE=3 SV=1 93 363 7.0E-33
sp|Q6CLZ9|SEC62_KLULA Translocation protein SEC62 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC62 PE=3 SV=1 103 338 3.0E-31
sp|P21825|SEC62_YEAST Translocation protein SEC62 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC62 PE=1 SV=2 107 319 1.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99161|SEC62_YARLI Translocation protein SEC62 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC62 PE=3 SV=2 104 326 2.0E-60
sp|O13787|SEC62_SCHPO Translocation protein sec62 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec62 PE=3 SV=1 107 388 1.0E-53
sp|Q5AI21|SEC62_CANAL Translocation protein SEC62 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC62 PE=3 SV=1 93 363 7.0E-33
sp|Q6CLZ9|SEC62_KLULA Translocation protein SEC62 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC62 PE=3 SV=1 103 338 3.0E-31
sp|P21825|SEC62_YEAST Translocation protein SEC62 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC62 PE=1 SV=2 107 319 1.0E-27
sp|Q6FRU9|SEC62_CANGA Translocation protein SEC62 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC62 PE=3 SV=1 107 317 1.0E-25
sp|Q6BI99|SEC62_DEBHA Translocation protein SEC62 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SEC62 PE=3 SV=1 107 343 2.0E-20
sp|Q75D26|SEC62_ASHGO Translocation protein SEC62 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC62 PE=3 SV=2 110 320 2.0E-17
sp|Q5R4Q3|SEC62_PONAB Translocation protein SEC62 OS=Pongo abelii GN=SEC62 PE=2 SV=1 220 363 2.0E-17
sp|Q99442|SEC62_HUMAN Translocation protein SEC62 OS=Homo sapiens GN=SEC62 PE=1 SV=1 220 364 3.0E-17
sp|Q8BU14|SEC62_MOUSE Translocation protein SEC62 OS=Mus musculus GN=Sec62 PE=1 SV=1 220 335 3.0E-17
sp|Q5F3A1|SEC62_CHICK Translocation protein SEC62 OS=Gallus gallus GN=SEC62 PE=2 SV=1 220 319 4.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0015031 protein transport Yes
GO:0030176 integral component of endoplasmic reticulum membrane Yes
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0070727 cellular macromolecule localization No
GO:0071705 nitrogen compound transport No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0031300 intrinsic component of organelle membrane No
GO:0031227 intrinsic component of endoplasmic reticulum membrane No
GO:0016021 integral component of membrane No
GO:0006810 transport No
GO:0051179 localization No
GO:0045184 establishment of protein localization No
GO:0033036 macromolecule localization No
GO:0009987 cellular process No
GO:0051641 cellular localization No
GO:0008104 protein localization No
GO:0005575 cellular_component No
GO:0071702 organic substance transport No
GO:0031301 integral component of organelle membrane No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide|Transmembrane domain 0.1008 0.3415 0.0375 0.2802 0.1335 0.0157 0.8988 0.1533 0.5805 0.0152

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 233 255 22
2 262 284 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5708
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|993
Ophiocordyceps australis map64 (Brazil) OphauB2|3372
Ophiocordyceps camponoti-floridani Ophcf2|04151
Ophiocordyceps kimflemingae Ophio5|3008 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8850

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3008
MSAQGPPFPPGQGPTPEQIAEMQRRVAEDAQKAGMSVPEFIAHIKKQTMQQQQQRMRMQQQQQHSHDGHHCCDHD
HGHDEDDDDDDHHHHSQGQSQPITPGPPNPKAIAVAKFLKSQELKPRTCILNGDRKDMFKVKRALRALQSPAYEK
ARKKNPLLPEVNDQATLENTFKLLPLSMLALRVSKIETELGPNGKKPKRVKGQWNVRVEQQQEAMQDMYYVWLWE
GSQIKRQLYAALALVIIFIIVLYPLWPLKLRQGVYYLSWGLLGLLGLFFLMAIFRVILFCVTYFAVPPGLWLYPN
LWEDVSFMDSFRPVWAWHETAEEKKLKKKSKKKARTAGSGAGTNATFAAATGQVAPTTATTTGTDTQIKTGDMHQ
RNYVAPKVEELADDE
Coding >Ophio5|3008
ATGTCTGCGCAGGGGCCACCGTTTCCGCCCGGCCAGGGCCCGACGCCGGAGCAGATCGCCGAAATGCAGCGAAGG
GTCGCCGAGGACGCGCAAAAGGCGGGCATGTCGGTGCCAGAGTTCATCGCCCACATCAAGAAGCAAACGATGCAG
CAGCAGCAGCAGCGCATGCGTATGCAGCAGCAACAGCAGCATTCGCACGACGGACACCACTGCTGCGACCATGAC
CACGGCCACGACGAAGACGATGATGATGACGATCACCATCACCACTCACAGGGCCAGTCCCAACCCATCACGCCA
GGGCCCCCGAATCCCAAGGCTATCGCCGTTGCCAAATTCCTCAAGAGTCAAGAGTTGAAACCGCGCACCTGCATC
CTAAATGGGGATCGAAAGGACATGTTTAAAGTCAAACGTGCTCTGCGGGCGCTGCAGTCGCCCGCCTACGAAAAA
GCCCGGAAGAAGAATCCCCTACTGCCGGAGGTCAATGACCAGGCCACGCTCGAGAATACGTTCAAGCTACTGCCT
CTGAGCATGCTTGCCTTGCGTGTTTCCAAGATTGAGACGGAGCTGGGTCCCAACGGCAAGAAGCCCAAGCGCGTA
AAGGGCCAGTGGAATGTTCGCGTCGAACAGCAGCAAGAGGCGATGCAAGACATGTACTACGTCTGGCTGTGGGAG
GGCAGCCAAATCAAGCGTCAGCTCTATGCGGCCCTGGCTCTCGTCATCATCTTCATCATCGTCCTATACCCGCTC
TGGCCGTTGAAGCTGCGCCAGGGCGTCTACTACCTCAGTTGGGGTCTGCTGGGCCTGCTGGGCCTGTTCTTCCTA
ATGGCCATCTTCCGTGTCATTCTCTTCTGTGTCACCTACTTCGCCGTCCCGCCCGGTCTCTGGCTCTACCCCAAT
CTGTGGGAGGATGTCTCCTTCATGGACAGCTTCAGACCCGTCTGGGCCTGGCACGAGACGGCCGAGGAAAAGAAG
TTGAAGAAGAAGTCGAAGAAGAAGGCCAGGACGGCCGGCTCCGGGGCCGGGACCAACGCCACGTTCGCTGCCGCT
ACCGGCCAGGTAGCGCCGACGACAGCTACAACCACCGGCACCGACACGCAGATCAAGACAGGCGATATGCACCAG
CGGAATTACGTCGCACCCAAGGTTGAGGAGCTAGCGGACGACGAG
Transcript >Ophio5|3008
ATGTCTGCGCAGGGGCCACCGTTTCCGCCCGGCCAGGGCCCGACGCCGGAGCAGATCGCCGAAATGCAGCGAAGG
GTCGCCGAGGACGCGCAAAAGGCGGGCATGTCGGTGCCAGAGTTCATCGCCCACATCAAGAAGCAAACGATGCAG
CAGCAGCAGCAGCGCATGCGTATGCAGCAGCAACAGCAGCATTCGCACGACGGACACCACTGCTGCGACCATGAC
CACGGCCACGACGAAGACGATGATGATGACGATCACCATCACCACTCACAGGGCCAGTCCCAACCCATCACGCCA
GGGCCCCCGAATCCCAAGGCTATCGCCGTTGCCAAATTCCTCAAGAGTCAAGAGTTGAAACCGCGCACCTGCATC
CTAAATGGGGATCGAAAGGACATGTTTAAAGTCAAACGTGCTCTGCGGGCGCTGCAGTCGCCCGCCTACGAAAAA
GCCCGGAAGAAGAATCCCCTACTGCCGGAGGTCAATGACCAGGCCACGCTCGAGAATACGTTCAAGCTACTGCCT
CTGAGCATGCTTGCCTTGCGTGTTTCCAAGATTGAGACGGAGCTGGGTCCCAACGGCAAGAAGCCCAAGCGCGTA
AAGGGCCAGTGGAATGTTCGCGTCGAACAGCAGCAAGAGGCGATGCAAGACATGTACTACGTCTGGCTGTGGGAG
GGCAGCCAAATCAAGCGTCAGCTCTATGCGGCCCTGGCTCTCGTCATCATCTTCATCATCGTCCTATACCCGCTC
TGGCCGTTGAAGCTGCGCCAGGGCGTCTACTACCTCAGTTGGGGTCTGCTGGGCCTGCTGGGCCTGTTCTTCCTA
ATGGCCATCTTCCGTGTCATTCTCTTCTGTGTCACCTACTTCGCCGTCCCGCCCGGTCTCTGGCTCTACCCCAAT
CTGTGGGAGGATGTCTCCTTCATGGACAGCTTCAGACCCGTCTGGGCCTGGCACGAGACGGCCGAGGAAAAGAAG
TTGAAGAAGAAGTCGAAGAAGAAGGCCAGGACGGCCGGCTCCGGGGCCGGGACCAACGCCACGTTCGCTGCCGCT
ACCGGCCAGGTAGCGCCGACGACAGCTACAACCACCGGCACCGACACGCAGATCAAGACAGGCGATATGCACCAG
CGGAATTACGTCGCACCCAAGGTTGAGGAGCTAGCGGACGACGAGTGA
Gene >Ophio5|3008
ATGTCTGCGCAGGGGCCACCGTTTCCGCCCGGCCAGGGCCCGACGCCGGAGCAGATCGCCGAAATGCAGCGAAGG
GTCGCCGAGGACGCGCAAAAGGCGGGCATGTCGGTGCCAGAGTTCATCGCCCACATCAAGAAGCAAACGATGCAG
CAGCAGCAGCAGCGCATGCGTATGCAGCAGCAACAGCAGCATTCGCACGACGGACACCACTGCTGCGACCATGAC
CACGGCCACGACGAAGACGATGATGATGACGATCACCATCACCACTCACAGGGCCAGTCCCAACCCATCACGCCA
GGGCCCCCGAATCCCAAGGCTATCGCCGTTGCCAAATTCCTCAAGAGTCAAGAGTTGAAACCGCGCACCTGCATC
CTAAATGGGGATCGAAAGGACATGTTTAAAGGCACGAGCTCGAAAATGGTACCCTTATAAGGCATTGAGACCACG
GCTCGCTAACGGGTACGACAGTCAAACGTGCTCTGCGGGCGCTGCAGTCGCCCGCCTACGAAAAAGCCCGGAAGA
AGAATCCCCTACTGCCGGAGGTCAATGACCAGGCCACGCTCGAGAATACGTTCAAGCTACTGCCTCTGAGCATGC
TTGCCTTGCGTGTTTCCAAGATTGAGACGGAGCTGGGTCCCAACGGCAAGAAGCCCAAGCGCGTAAAGGGCCAGT
GGAATGTTCGCGTCGAACAGCAGCAAGAGGCGATGCAAGACATGTACTACGTCTGGCTGTGGGAGGGCAGCCAAA
TCAAGCGTCAGCTCTATGCGGCCCTGGCTCTCGTCATCATCTTCATCATCGTCCTATACCCGCTCTGGCCGTTGA
AGCTGCGCCAGGGCGTCTACTACCTCAGTTGGGGTCTGCTGGGCCTGCTGGGCCTGTTCTTCCTAATGGCCATCT
TCCGTGTCATTCTCTTCTGTGTCACCTACTTCGCCGTCCCGCCCGGTCTCTGGCTCTACCCCAATCTGTGGGAGG
ATGTCTCCTTCATGGACAGCTTCAGACCCGTCTGGGCCTGGCACGAGGTAAGTTTGGAAACTTGGCCTTCTCGGC
ATGCACCTGCCCCCGTACATACTGATGTCGCCGCAGACGGCCGAGGAAAAGAAGTTGAAGAAGAAGTCGAAGAAG
AAGGCCAGGACGGCCGGCTCCGGGGCCGGGACCAACGCCACGTTCGCTGCCGCTACCGGCCAGGTAGCGCCGACG
ACAGCTACAACCACCGGCACCGACACGCAGATCAAGACAGGCGATATGCACCAGCGGAATTACGTCGCACCCAAG
GTTGAGGAGCTAGCGGACGACGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail