Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2998
Gene name
Locationscaffold_239:23914..24652
Strand-
Gene length (bp)738
Transcript length (bp)624
Coding sequence length (bp)621
Protein length (aa) 207

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04117 Mpv17_PMP22 Mpv17 / PMP22 family 2.5E-19 140 201

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q54GD8|PX24C_DICDI PXMP2/4 family protein 3 OS=Dictyostelium discoideum GN=DDB_G0290223 PE=3 SV=1 3 206 1.0E-12
sp|Q9V492|MPV17_DROME Mpv17-like protein OS=Drosophila melanogaster GN=CG11077 PE=2 SV=1 112 203 8.0E-09
sp|Q66GV0|MPV17_XENLA Protein Mpv17 OS=Xenopus laevis GN=mpv17 PE=2 SV=2 135 206 5.0E-07

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 120 142 22
2 157 179 22
3 186 205 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2998
MPSPILTATLQAAGLSMASNLCAQFLEAYQNQHAFIPDPRQLCRFLALTFITTPPNYMWQQLLERTFPSHPRVIS
PLAAEGFELKAAEEATAAAVPPQTMTTTTTTARPLSLRNTATKWFVDCITLGALGNTMAFLILMGLLKGQPGLHI
WNNVRSETIPIIIAGYKIWPLASIISFSFVPVHRRVVFLSFVGLLWGVYMSLVAARV
Coding >Ophio5|2998
ATGCCTTCTCCCATCCTCACCGCCACCCTCCAAGCAGCCGGCCTATCCATGGCCTCCAACCTATGCGCCCAATTC
CTCGAAGCCTACCAAAACCAGCACGCCTTCATTCCCGACCCGCGCCAATTATGTCGCTTCCTCGCTCTGACGTTC
ATCACCACGCCTCCTAATTACATGTGGCAGCAGCTACTAGAGCGCACCTTTCCCTCACATCCGCGCGTCATCTCC
CCCCTTGCTGCGGAAGGCTTCGAGCTTAAGGCTGCTGAAGAGGCTACTGCCGCTGCTGTGCCGCCGCAGACGATG
ACGACGACGACGACGACGGCTCGACCGCTGAGTTTGCGCAATACCGCGACCAAGTGGTTCGTTGATTGTATCACG
CTCGGCGCTTTGGGCAATACCATGGCGTTTTTGATTCTCATGGGCTTGCTCAAGGGTCAGCCTGGTTTGCATATC
TGGAATAATGTTCGCTCGGAGACGATACCCATCATCATTGCTGGCTACAAGATCTGGCCGCTCGCTTCCATCATC
AGCTTCTCCTTTGTGCCCGTCCACCGCCGCGTCGTCTTTCTCAGCTTCGTCGGTCTGCTGTGGGGGGTTTATATG
AGTCTCGTGGCCGCGCGCGTG
Transcript >Ophio5|2998
ATGCCTTCTCCCATCCTCACCGCCACCCTCCAAGCAGCCGGCCTATCCATGGCCTCCAACCTATGCGCCCAATTC
CTCGAAGCCTACCAAAACCAGCACGCCTTCATTCCCGACCCGCGCCAATTATGTCGCTTCCTCGCTCTGACGTTC
ATCACCACGCCTCCTAATTACATGTGGCAGCAGCTACTAGAGCGCACCTTTCCCTCACATCCGCGCGTCATCTCC
CCCCTTGCTGCGGAAGGCTTCGAGCTTAAGGCTGCTGAAGAGGCTACTGCCGCTGCTGTGCCGCCGCAGACGATG
ACGACGACGACGACGACGGCTCGACCGCTGAGTTTGCGCAATACCGCGACCAAGTGGTTCGTTGATTGTATCACG
CTCGGCGCTTTGGGCAATACCATGGCGTTTTTGATTCTCATGGGCTTGCTCAAGGGTCAGCCTGGTTTGCATATC
TGGAATAATGTTCGCTCGGAGACGATACCCATCATCATTGCTGGCTACAAGATCTGGCCGCTCGCTTCCATCATC
AGCTTCTCCTTTGTGCCCGTCCACCGCCGCGTCGTCTTTCTCAGCTTCGTCGGTCTGCTGTGGGGGGTTTATATG
AGTCTCGTGGCCGCGCGCGTGTAG
Gene >Ophio5|2998
ATGCCTTCTCCCATCCTCACCGCCACCCTCCAAGCAGCCGGCCTATCCATGGCCTCCAACCTATGCGCCCAATTC
CTCGAAGCCTACCAAAACCAGGTAAAAAAACAACCAAACAACCCTTTCGACAATTCTGACAAGTGCAGCACGCCT
TCATTCCCGACCCGCGCCAATTATGTCGCTTCCTCGCTCTGACGTTCATCACCACGCCTCCTAATTACATGTGGC
AGCAGCTACTAGAGCGCACCTTTCCCTCACATCCGCGCGTCATCTCCCCCCTTGCTGCGGAAGGCTTCGAGCTTA
AGGCTGCTGAAGAGGCTACTGCCGCTGCTGTGCCGCCGCAGACGATGACGACGACGACGACGACGGCTCGACCGC
TGAGTTTGCGCAATACCGCGACCAAGTGGTTCGTTGATTGTATCACGCTCGGCGCTTTGGGCAATACCATGGCGT
TTTTGATTCTCATGGGCTTGCTCAAGGGTCAGCCTGGTTTGCATATCTGGAATAATGTTCGCTCGGTGCGTCTTC
TCGGGGGGGAAGGCGTTGACAGGTTGGGCAACAGTCTTGCGGCTGACGCCGTTACAGGAGACGATACCCATCATC
ATTGCTGGCTACAAGATCTGGCCGCTCGCTTCCATCATCAGCTTCTCCTTTGTGCCCGTCCACCGCCGCGTCGTC
TTTCTCAGCTTCGTCGGTCTGCTGTGGGGGGTTTATATGAGTCTCGTGGCCGCGCGCGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail