Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2995
Gene name
Locationscaffold_239:11730..19581
Strand-
Gene length (bp)7851
Transcript length (bp)7140
Coding sequence length (bp)7137
Protein length (aa) 2379

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00626 Gelsolin Gelsolin repeat 4.7E-11 63 148
PF00626 Gelsolin Gelsolin repeat 1.4E-09 197 246

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10733|SEVE_DICDI Severin OS=Dictyostelium discoideum GN=sevA PE=1 SV=1 7 384 5.0E-68
sp|Q7JQD3|GELS1_LUMTE Gelsolin-like protein 1 OS=Lumbricus terrestris GN=AM PE=1 SV=1 6 366 6.0E-66
sp|Q8MPM1|GELS2_LUMTE Gelsolin-like protein 2 OS=Lumbricus terrestris GN=gelsolin PE=1 SV=1 6 366 3.0E-60
sp|Q24800|SEVE_ECHGR Severin OS=Echinococcus granulosus GN=AG8 PE=2 SV=3 6 365 2.0E-59
sp|O93510|GELS_CHICK Gelsolin OS=Gallus gallus GN=GSN PE=2 SV=1 48 366 3.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10733|SEVE_DICDI Severin OS=Dictyostelium discoideum GN=sevA PE=1 SV=1 7 384 5.0E-68
sp|Q7JQD3|GELS1_LUMTE Gelsolin-like protein 1 OS=Lumbricus terrestris GN=AM PE=1 SV=1 6 366 6.0E-66
sp|Q8MPM1|GELS2_LUMTE Gelsolin-like protein 2 OS=Lumbricus terrestris GN=gelsolin PE=1 SV=1 6 366 3.0E-60
sp|Q24800|SEVE_ECHGR Severin OS=Echinococcus granulosus GN=AG8 PE=2 SV=3 6 365 2.0E-59
sp|O93510|GELS_CHICK Gelsolin OS=Gallus gallus GN=GSN PE=2 SV=1 48 366 3.0E-47
sp|Q07171|GELS_DROME Gelsolin OS=Drosophila melanogaster GN=Gel PE=1 SV=2 46 368 2.0E-46
sp|O61270|GELS_HALRO Gelsolin, cytoplasmic OS=Halocynthia roretzi PE=1 SV=1 48 354 1.0E-44
sp|Q68FP1|GELS_RAT Gelsolin OS=Rattus norvegicus GN=Gsn PE=1 SV=1 48 368 2.0E-44
sp|P13020|GELS_MOUSE Gelsolin OS=Mus musculus GN=Gsn PE=1 SV=3 48 368 8.0E-44
sp|P20305|GELS_PIG Gelsolin (Fragment) OS=Sus scrofa GN=GSN PE=1 SV=1 48 366 9.0E-44
sp|Q3SX14|GELS_BOVIN Gelsolin OS=Bos taurus GN=GSN PE=2 SV=1 48 366 3.0E-43
sp|P06396|GELS_HUMAN Gelsolin OS=Homo sapiens GN=GSN PE=1 SV=1 48 366 8.0E-43
sp|Q5ZIV9|ADSV_CHICK Adseverin OS=Gallus gallus GN=SCIN PE=2 SV=2 48 366 6.0E-42
sp|Q28372|GELS_HORSE Gelsolin OS=Equus caballus GN=GSN PE=1 SV=2 48 366 2.0E-41
sp|Q27319|GELS_HOMAM Gelsolin, cytoplasmic OS=Homarus americanus PE=1 SV=1 51 367 2.0E-41
sp|P09327|VILI_HUMAN Villin-1 OS=Homo sapiens GN=VIL1 PE=1 SV=4 51 368 2.0E-39
sp|Q9Y6U3|ADSV_HUMAN Adseverin OS=Homo sapiens GN=SCIN PE=1 SV=4 48 366 4.0E-39
sp|Q28046|ADSV_BOVIN Adseverin OS=Bos taurus GN=SCIN PE=1 SV=1 48 366 4.0E-39
sp|P02640|VILI_CHICK Villin-1 OS=Gallus gallus GN=VIL1 PE=1 SV=2 51 367 5.0E-39
sp|Q3SZP7|VILI_BOVIN Villin-1 OS=Bos taurus GN=VIL1 PE=2 SV=3 51 368 7.0E-39
sp|Q62468|VILI_MOUSE Villin-1 OS=Mus musculus GN=Vil1 PE=1 SV=3 51 368 2.0E-38
sp|Q60604|ADSV_MOUSE Adseverin OS=Mus musculus GN=Scin PE=1 SV=3 48 372 3.0E-38
sp|A8XV95|GELS1_CAEBR Gelsolin-like protein 1 OS=Caenorhabditis briggsae GN=gsnl-1 PE=3 SV=1 45 368 2.0E-37
sp|Q29261|VILI_PIG Villin-1 OS=Sus scrofa GN=VIL1 PE=2 SV=2 51 368 2.0E-37
sp|Q21253|GELS1_CAEEL Gelsolin-like protein 1 OS=Caenorhabditis elegans GN=gsnl-1 PE=1 SV=1 45 368 3.0E-37
sp|O75366|AVIL_HUMAN Advillin OS=Homo sapiens GN=AVIL PE=1 SV=3 46 367 7.0E-36
sp|P40121|CAPG_HUMAN Macrophage-capping protein OS=Homo sapiens GN=CAPG PE=1 SV=2 45 368 3.0E-34
sp|O81644|VILI2_ARATH Villin-2 OS=Arabidopsis thaliana GN=VLN2 PE=1 SV=2 48 250 2.0E-33
sp|P24452|CAPG_MOUSE Macrophage-capping protein OS=Mus musculus GN=Capg PE=1 SV=2 49 366 4.0E-33
sp|Q9WU06|AVIL_RAT Advillin OS=Rattus norvegicus GN=Avil PE=2 SV=1 46 367 7.0E-33
sp|Q6AYC4|CAPG_RAT Macrophage-capping protein OS=Rattus norvegicus GN=Capg PE=1 SV=1 49 366 7.0E-33
sp|O88398|AVIL_MOUSE Advillin OS=Mus musculus GN=Avil PE=1 SV=2 46 367 9.0E-33
sp|Q9LVC6|VILI5_ARATH Villin-5 OS=Arabidopsis thaliana GN=VLN5 PE=2 SV=1 48 365 2.0E-32
sp|O81645|VILI3_ARATH Villin-3 OS=Arabidopsis thaliana GN=VLN3 PE=1 SV=2 47 364 2.0E-32
sp|O65570|VILI4_ARATH Villin-4 OS=Arabidopsis thaliana GN=VLN4 PE=1 SV=1 48 250 6.0E-32
sp|Q865V6|CAPG_BOVIN Macrophage-capping protein OS=Bos taurus GN=CAPG PE=2 SV=1 51 366 2.0E-30
sp|P13020|GELS_MOUSE Gelsolin OS=Mus musculus GN=Gsn PE=1 SV=3 18 365 3.0E-25
sp|O75366|AVIL_HUMAN Advillin OS=Homo sapiens GN=AVIL PE=1 SV=3 36 365 7.0E-25
sp|O93510|GELS_CHICK Gelsolin OS=Gallus gallus GN=GSN PE=2 SV=1 36 365 2.0E-24
sp|Q68FP1|GELS_RAT Gelsolin OS=Rattus norvegicus GN=Gsn PE=1 SV=1 18 365 9.0E-24
sp|P20305|GELS_PIG Gelsolin (Fragment) OS=Sus scrofa GN=GSN PE=1 SV=1 18 365 1.0E-23
sp|P14885|GELS_XENLA Gelsolin (Fragment) OS=Xenopus laevis GN=gsn PE=2 SV=1 54 365 2.0E-23
sp|P06396|GELS_HUMAN Gelsolin OS=Homo sapiens GN=GSN PE=1 SV=1 18 365 3.0E-23
sp|P34268|FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans GN=fli-1 PE=2 SV=2 44 368 5.0E-23
sp|Q3SX14|GELS_BOVIN Gelsolin OS=Bos taurus GN=GSN PE=2 SV=1 54 365 2.0E-22
sp|O88398|AVIL_MOUSE Advillin OS=Mus musculus GN=Avil PE=1 SV=2 36 364 3.0E-22
sp|Q28372|GELS_HORSE Gelsolin OS=Equus caballus GN=GSN PE=1 SV=2 35 364 7.0E-22
sp|P09327|VILI_HUMAN Villin-1 OS=Homo sapiens GN=VIL1 PE=1 SV=4 18 365 1.0E-21
sp|P02640|VILI_CHICK Villin-1 OS=Gallus gallus GN=VIL1 PE=1 SV=2 18 365 6.0E-21
sp|Q24020|FLII_DROME Protein flightless-1 OS=Drosophila melanogaster GN=fliI PE=2 SV=1 48 415 8.0E-21
sp|Q28046|ADSV_BOVIN Adseverin OS=Bos taurus GN=SCIN PE=1 SV=1 36 392 2.0E-20
sp|Q62468|VILI_MOUSE Villin-1 OS=Mus musculus GN=Vil1 PE=1 SV=3 36 385 2.0E-20
sp|Q27319|GELS_HOMAM Gelsolin, cytoplasmic OS=Homarus americanus PE=1 SV=1 53 365 3.0E-20
sp|Q9Y6U3|ADSV_HUMAN Adseverin OS=Homo sapiens GN=SCIN PE=1 SV=4 36 392 4.0E-20
sp|Q3SZP7|VILI_BOVIN Villin-1 OS=Bos taurus GN=VIL1 PE=2 SV=3 18 365 4.0E-19
sp|Q29261|VILI_PIG Villin-1 OS=Sus scrofa GN=VIL1 PE=2 SV=2 18 365 4.0E-19
sp|O81643|VILI1_ARATH Villin-1 OS=Arabidopsis thaliana GN=VLN1 PE=2 SV=2 47 367 2.0E-18
sp|Q60604|ADSV_MOUSE Adseverin OS=Mus musculus GN=Scin PE=1 SV=3 36 392 3.0E-18
sp|Q8WQ85|VILD_DICDI Villidin OS=Dictyostelium discoideum GN=vilA PE=1 SV=2 53 354 5.0E-18
sp|Q9WU06|AVIL_RAT Advillin OS=Rattus norvegicus GN=Avil PE=2 SV=1 36 364 1.0E-17
sp|Q9JJ28|FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus GN=Flii PE=1 SV=1 30 397 1.0E-17
sp|O15195|VILL_HUMAN Villin-like protein OS=Homo sapiens GN=VILL PE=2 SV=3 48 365 2.0E-17
sp|Q13045|FLII_HUMAN Protein flightless-1 homolog OS=Homo sapiens GN=FLII PE=1 SV=2 30 397 1.0E-16
sp|Q91YD6|VILL_MOUSE Villin-like protein OS=Mus musculus GN=Vill PE=1 SV=1 46 367 1.0E-16
sp|O81645|VILI3_ARATH Villin-3 OS=Arabidopsis thaliana GN=VLN3 PE=1 SV=2 53 429 3.0E-16
sp|Q5ZIV9|ADSV_CHICK Adseverin OS=Gallus gallus GN=SCIN PE=2 SV=2 36 392 1.0E-15
sp|Q23989|QUAI_DROME Villin-like protein quail OS=Drosophila melanogaster GN=qua PE=2 SV=2 55 385 1.0E-13
sp|O15195|VILL_HUMAN Villin-like protein OS=Homo sapiens GN=VILL PE=2 SV=3 53 354 1.0E-12
sp|Q91YD6|VILL_MOUSE Villin-like protein OS=Mus musculus GN=Vill PE=1 SV=1 53 385 1.0E-11
sp|O61270|GELS_HALRO Gelsolin, cytoplasmic OS=Halocynthia roretzi PE=1 SV=1 36 365 6.0E-11
sp|P36418|VILB_DICDI Protovillin OS=Dictyostelium discoideum GN=vilB PE=1 SV=1 8 360 1.0E-10
sp|O81644|VILI2_ARATH Villin-2 OS=Arabidopsis thaliana GN=VLN2 PE=1 SV=2 53 385 4.0E-10
sp|Q29297|ADSV_PIG Adseverin (Fragment) OS=Sus scrofa GN=SCIN PE=2 SV=1 135 241 1.0E-08
sp|A8XV95|GELS1_CAEBR Gelsolin-like protein 1 OS=Caenorhabditis briggsae GN=gsnl-1 PE=3 SV=1 208 366 2.0E-07
sp|Q21253|GELS1_CAEEL Gelsolin-like protein 1 OS=Caenorhabditis elegans GN=gsnl-1 PE=1 SV=1 208 366 7.0E-07
sp|O95425|SVIL_HUMAN Supervillin OS=Homo sapiens GN=SVIL PE=1 SV=2 55 127 2.0E-06
sp|Q8K4L3|SVIL_MOUSE Supervillin OS=Mus musculus GN=Svil PE=1 SV=1 55 135 4.0E-06
sp|O65570|VILI4_ARATH Villin-4 OS=Arabidopsis thaliana GN=VLN4 PE=1 SV=1 52 429 5.0E-06
sp|Q07171|GELS_DROME Gelsolin OS=Drosophila melanogaster GN=Gel PE=1 SV=2 183 363 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

Domain # Start End Length
1 517 539 22
2 629 651 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2995
MAPRDGLVHPKEYDILDSNVEFIGSDMDHRVKYNSAATEPAWNDGSVGREPGLRVWRIEQFQVVPWPKQRYGDFY
DGDSYLVLHSQRPADAKADSKKLRHDIFFWLGSHTTQDEAGTAAYKTVELDEFLHGAATQHREVQCAPSDEFLAL
FPRMSILSGGVRSGFRHVEDEAGKKGKQSKRTLLRVFQAGVGGSDVIVYEVQPTWRSLDDGDVFILDDGSKIWVW
QGRGCSPMEKAKAAQVVHDMTQAKHVEVEVTSQDEPRSRRIVDLLGGDQSTPREGFCHPRPMGVSPPAASQRRLF
RLSDASGRLELSLVKEGGQISAADLDGNDVFLLDDAGRGLWVWEGRGSSRAEKARWLAAARAYVQRRQEKSDEAL
AMPVAKVVEGCVMSWSSVFVVSAFVHSTTSASRIGIPYTHLEGALPANTLPRRRRHAWSVTCPSQTPPRRATNID
LNINTAMDGTIPVSIDSNACVRCVSRPASYLRRAVIAGSYPLRGIWYCARDSDFWPLFAGRLLPLSLISLAVYSV
LFTFAFLPQYAFIAILHGWGAWLNAVVLTLGEGLVITQALFEGFFVDECRVDVFDAILIKRGLADLVAPHRLLHD
DALSAVKMLGKPTSPAAYQPWSVIQIIELIVFLPLNLVPIVGTPAFIIITGTRLGKLSQYRWFQLRGLSRRERKR
EIGGLTWDYVCGGSGREWRVSAAGLYGRCGLKWQAPSPSVSCSSKSRDVAGLPLQFLPHIDDHEWNDASTSPPQR
SFDLEPSFEVFEPSFEAPGVIPATQEVAQEVADDLEPRRSSAGCLPGRGLFVTLVGADAGLKDTVRTTPRRRPLL
WRRSRKRSGAGEQAFLRRHRCHGGLSVDLCAAAFTLPIVRFCRRPLLPPRCHRYAPDACHLPCSFSAVLRATPTK
PVTRKPCLPPHPPSVQRLRPNTFQPSRCGRRLLPRVQSRHGACCSSLASFSPRHLSEFFPPLILRPPTFVSPFPQ
SFSPFTRLPSNLSALLPSSPLPRPPSAVTTRRNIVVFPRLPSAMRVLASVGVLAVSGILHGSPAHAAGYGPSDGG
SGAETYGEPGRDGQGDGSSATLEGLPAASATGPTCMAGATTTVFVTVYPTSPASADDSVSAAGAPEQTAHRTVHA
SPVGRSSSHSVSMWTTVTWDLSGVGGSNGMSGSPVSGSGAASSFANGASHTTQGSPNGGYGDITGSSAVAGWPRP
TVTSDTTGPGESGASGDDAGSPFGTGLTAASDGSPSAYGSANAAQASPSDQGRHGAGDSPAWQTVVTDTEVHWVP
GPSGPTPVTVVSEHTVVAAGPTQAPAGGQPVTCLTTTGPDGRPTVLQWPAGSPQASVGPVVSTAGLPDENGNAGA
QAFSTLNVPASAGAASTTCTTYTVLGTDGVPTVVHSSWLVPQAGPVTATSGPLPSGVSGPASAQNAPDGDGIATC
TSVTIVGPDGKPTVVESTLVLPGTAGVQGGAPGNLPGGSPVQVTSLLGNPGSVQPGGNQLPGGGHVTCTTFTVLG
ADGLPTVVDTTFVAPGPAATPVTTIAGGGVLGAPSQTTGSAVLPQPGGAGSQGITTCITFTTLGPDGKPTAVEST
IVVPATPSPVVAPGGAFTGAPAQITGSAVLPQPGGAGSQGITTCITFTTLGPDGKPTAVESTIVVPATPSPVVAP
GGAFTGAPAQITGSAVLPQPAGAGSKGITTCITFTTLGPDGKPTAVESTVVVPATLVPGGVFTGEPSQITDSAVL
PQPGGAGSQGITTCITITSLGPDGKPTVVESTVVVPASNALPPVTVLGLPSLPPPQPSNIPQGAPVFTSLGSPVT
TCLTFDVLGPNGVATPVVRTIVLTPAAAPSATTLGYPSITAQQQVTDLPQGVSPSAAAYGAVTTRVTMFSVGPNG
VATPIVQTVVLTPSAAALGLPTAPQAPNAAGFTLQPPGPVVQGSQPSTLAPGVPSLDAYGPDAPNVQSPSLPSGV
VSGLNVGTLTGPLTTVVTLVGGQPGASGAAGLPFPYGDGTGVSAAGVGAQPGDANHNGYGWSPTSAGLYGPQASP
VVAQPLLTVTTLQTLTWTNFIPEPTTTYTMNFPLTTLETVVISAPLGKRVLRRQQSSPPLDPSWSNATAVVPPVA
ESTPIQPVFTPFPDVATPLPAIPIPAASVVPSVPSSGTVCPFGGKIGNMTVDFDDVKPGPLFNPSGDVWFSEGFL
VAPPAAQVAQSFVPSSGGQLVEFVPPSLAGMSIGHQGSGDRAEVGVGPNAAKPCFRFDFFSAELGCAATGIEGWC
EFEVAAYRFDAGVSFEQSIAWSETKRVPACPSFPSGTCSLTPVAFEGYTNISSVLINVRVGLEMRAWWGDDFKFG
WTDSSCEAASCRALAAPQHVKRETVELALSRGVWHWTPAGLQRLDDDYIRKSAH
Coding >Ophio5|2995
ATGGCACCCCGCGACGGACTAGTACACCCGAAAGAGTACGATATCCTCGACAGCAACGTCGAGTTCATTGGATCC
GACATGGACCATCGCGTCAAGTACAACTCGGCGGCCACAGAGCCGGCATGGAACGACGGGTCTGTAGGGCGCGAG
CCGGGACTCCGCGTCTGGCGCATCGAGCAGTTCCAGGTGGTGCCGTGGCCGAAGCAGCGCTACGGCGACTTTTAC
GACGGAGACAGTTACCTCGTGCTCCATTCGCAGCGGCCGGCCGACGCCAAGGCCGACTCGAAGAAGCTGCGGCAC
GACATCTTCTTTTGGCTGGGCAGCCACACGACCCAGGATGAGGCCGGAACAGCGGCTTACAAGACGGTCGAGCTG
GACGAGTTCCTGCACGGGGCGGCGACGCAGCATCGCGAAGTGCAGTGTGCACCGTCTGATGAGTTCCTGGCGCTG
TTTCCGCGCATGTCTATTCTGTCCGGCGGAGTGCGCTCGGGCTTCCGTCACGTCGAGGACGAGGCGGGCAAGAAA
GGCAAACAATCGAAGCGGACGCTGCTGCGCGTCTTCCAGGCCGGCGTCGGAGGCAGCGACGTCATCGTCTACGAA
GTACAGCCTACGTGGCGCAGTCTCGACGACGGCGACGTCTTCATCCTCGACGATGGCTCCAAGATATGGGTCTGG
CAAGGCCGTGGCTGCAGTCCGATGGAGAAGGCCAAAGCGGCGCAGGTGGTACACGATATGACACAAGCCAAGCAC
GTCGAAGTCGAGGTGACATCACAAGACGAGCCGCGATCGCGACGCATCGTCGACCTCCTCGGCGGCGACCAATCG
ACCCCACGCGAAGGCTTCTGCCACCCGCGGCCCATGGGCGTTTCCCCCCCGGCTGCGTCCCAGAGGCGACTGTTC
CGTCTGAGCGACGCTTCGGGTCGGCTGGAGCTTAGCCTCGTCAAGGAGGGCGGGCAGATATCTGCGGCGGACCTC
GACGGTAACGATGTCTTTCTCCTCGACGATGCGGGACGCGGACTCTGGGTCTGGGAGGGCAGGGGCTCGAGTCGT
GCCGAGAAGGCGAGGTGGTTGGCGGCGGCGCGAGCGTATGTCCAGCGTAGGCAGGAGAAGAGTGATGAGGCGTTG
GCGATGCCGGTCGCCAAGGTGGTGGAAGGGTGCGTCATGTCTTGGTCTTCTGTGTTTGTAGTGTCGGCCTTCGTC
CATTCCACGACGTCAGCGAGCCGCATCGGCATACCCTATACCCACCTGGAGGGCGCCCTACCCGCTAACACGCTC
CCACGCCGTCGTCGTCATGCCTGGAGCGTCACATGCCCGTCTCAGACTCCTCCTAGACGCGCAACAAACATCGAC
TTGAACATCAACACCGCCATGGACGGAACGATCCCCGTCAGCATCGACAGCAACGCGTGCGTCCGCTGCGTCTCT
CGACCGGCCTCGTACCTGCGCCGTGCCGTCATCGCTGGCTCGTACCCGCTGCGCGGCATCTGGTACTGCGCGCGA
GACAGCGACTTTTGGCCTCTCTTCGCTGGCAGGCTGTTGCCACTGTCCCTCATCTCCCTCGCCGTTTACTCTGTG
CTCTTTACCTTTGCCTTTTTGCCGCAATATGCCTTTATTGCAATCTTACATGGTTGGGGCGCCTGGCTTAACGCT
GTGGTTTTGACGCTCGGTGAGGGCCTGGTCATCACGCAGGCGCTGTTTGAGGGCTTCTTTGTCGACGAGTGCCGC
GTCGACGTCTTCGATGCTATCCTAATTAAGCGCGGCCTTGCCGATCTCGTCGCGCCGCACCGCCTCCTCCACGAC
GACGCGCTCAGCGCCGTCAAGATGCTCGGCAAGCCAACCAGTCCAGCCGCCTACCAACCCTGGAGCGTGATCCAG
ATTATCGAGCTCATCGTCTTCCTACCGCTCAACCTGGTACCCATTGTCGGTACGCCCGCCTTCATCATCATTACG
GGCACCCGTCTTGGCAAGTTGTCGCAATATCGCTGGTTCCAGCTCCGTGGCCTGTCGCGGCGCGAGCGCAAGCGC
GAGATTGGGGGGTTGACGTGGGATTATGTCTGTGGAGGCTCGGGTCGGGAGTGGAGGGTCTCCGCCGCCGGCCTA
TACGGACGATGTGGCCTGAAGTGGCAGGCTCCTTCCCCTAGCGTCTCCTGCTCTAGCAAGTCCCGAGACGTCGCC
GGCCTGCCGCTACAGTTCCTTCCACACATTGACGACCATGAATGGAATGACGCTTCCACCTCACCGCCCCAGCGC
AGTTTCGACCTCGAACCATCGTTCGAGGTCTTCGAACCATCGTTCGAGGCTCCTGGCGTGATACCTGCGACGCAA
GAAGTTGCCCAAGAAGTTGCCGATGACTTGGAGCCGAGGAGGAGCAGCGCTGGCTGCCTGCCCGGGCGTGGACTG
TTTGTTACCTTGGTAGGAGCGGATGCAGGCCTTAAAGACACCGTGCGGACGACTCCGAGGAGAAGGCCCCTTCTC
TGGCGTCGTTCCCGGAAACGGTCCGGCGCCGGGGAGCAAGCCTTCCTCCGGAGGCATCGCTGTCACGGCGGGCTT
TCCGTGGATCTCTGCGCCGCTGCTTTTACGCTTCCAATTGTACGCTTTTGCCGTCGTCCGCTGTTGCCTCCACGC
TGCCACCGCTACGCCCCCGATGCCTGCCATCTTCCGTGCTCTTTCTCCGCCGTACTGCGCGCTACACCGACTAAG
CCGGTGACCCGGAAGCCGTGCCTTCCTCCTCACCCCCCCTCCGTCCAACGCCTGCGCCCCAACACCTTCCAACCG
TCTCGCTGTGGCAGGAGACTCCTTCCGCGAGTGCAGTCCCGCCATGGAGCCTGCTGCTCTTCCCTCGCCAGCTTC
TCGCCTCGCCATCTGTCAGAATTCTTTCCCCCCCTCATCCTCCGTCCGCCGACCTTCGTCTCTCCTTTTCCTCAG
TCCTTTTCCCCCTTCACTCGTTTGCCCTCTAACCTATCAGCTCTACTCCCATCATCTCCTCTTCCTCGTCCTCCC
TCAGCCGTCACAACCCGCCGCAACATCGTCGTCTTTCCCCGCCTCCCCTCCGCGATGCGTGTCCTCGCGTCCGTC
GGGGTCCTGGCGGTCAGCGGCATCCTCCACGGTTCGCCTGCCCATGCAGCTGGCTATGGACCTTCCGACGGCGGC
TCTGGGGCCGAAACCTACGGCGAGCCCGGTCGTGATGGCCAAGGCGATGGCTCATCTGCCACTCTCGAGGGCTTG
CCGGCTGCGTCTGCTACCGGTCCGACATGCATGGCTGGGGCCACGACTACTGTCTTCGTCACAGTCTACCCAACT
AGTCCTGCGTCTGCCGATGACTCCGTTTCGGCTGCCGGTGCCCCTGAGCAGACTGCCCACCGCACTGTCCATGCT
TCTCCTGTTGGCCGCTCGTCATCCCACTCCGTTTCCATGTGGACCACCGTTACCTGGGATTTGTCGGGCGTTGGT
GGTTCTAACGGCATGTCTGGCTCTCCTGTCTCCGGCTCTGGTGCTGCTTCCTCCTTTGCGAACGGCGCCTCTCAC
ACCACGCAAGGCTCTCCCAATGGCGGCTACGGCGATATCACTGGCTCTTCCGCTGTTGCTGGCTGGCCAAGACCG
ACCGTCACGTCTGATACAACTGGCCCAGGCGAGAGTGGCGCCTCTGGCGATGACGCCGGATCGCCCTTCGGCACA
GGCTTGACGGCTGCCTCCGATGGATCCCCTTCTGCCTACGGTTCCGCCAATGCGGCTCAGGCCTCCCCGTCCGAT
CAAGGCCGCCACGGAGCCGGAGACAGCCCTGCTTGGCAGACTGTGGTGACGGACACCGAAGTCCACTGGGTTCCT
GGACCCTCGGGCCCGACCCCTGTCACCGTCGTTTCGGAGCACACCGTCGTTGCGGCCGGCCCCACGCAAGCTCCC
GCTGGCGGCCAACCCGTGACCTGCCTGACCACCACCGGTCCCGATGGGCGTCCGACCGTGCTTCAGTGGCCGGCT
GGAAGCCCGCAAGCCAGTGTCGGCCCCGTGGTGTCGACTGCTGGTCTGCCTGACGAAAACGGTAATGCTGGCGCC
CAGGCCTTCTCCACACTCAACGTCCCCGCCTCGGCCGGCGCAGCTTCAACGACGTGCACCACGTACACTGTCCTT
GGCACCGACGGCGTGCCCACAGTTGTCCATTCGTCTTGGCTTGTTCCCCAAGCTGGCCCTGTCACCGCCACTTCC
GGCCCTTTGCCCTCTGGCGTCTCTGGCCCGGCCTCTGCTCAGAACGCCCCCGACGGCGACGGCATCGCGACTTGC
ACCAGCGTCACCATTGTCGGACCCGATGGAAAGCCAACGGTTGTGGAATCCACCCTCGTTCTTCCCGGCACTGCG
GGCGTCCAAGGCGGAGCCCCTGGGAACCTTCCTGGCGGAAGCCCAGTCCAGGTGACCTCTCTGCTGGGCAACCCC
GGCTCTGTTCAGCCCGGTGGCAATCAACTTCCGGGAGGCGGCCACGTCACTTGCACCACTTTCACCGTCCTCGGC
GCCGATGGCCTTCCGACCGTTGTTGACACCACTTTTGTTGCTCCCGGCCCTGCCGCTACCCCCGTCACCACCATC
GCAGGCGGAGGCGTCCTGGGCGCGCCGTCTCAGACCACCGGTTCCGCCGTGCTTCCTCAACCGGGAGGCGCTGGT
TCTCAGGGCATCACGACATGCATTACCTTCACCACCCTCGGGCCTGATGGCAAGCCGACTGCGGTCGAGTCCACC
ATTGTGGTGCCTGCCACTCCGTCTCCCGTCGTCGCTCCCGGAGGCGCCTTCACGGGCGCGCCAGCTCAAATCACC
GGTTCCGCCGTGCTTCCTCAACCGGGAGGCGCTGGTTCTCAGGGCATCACGACATGCATCACCTTCACCACCCTC
GGGCCTGATGGCAAGCCGACTGCGGTCGAGTCCACCATTGTGGTGCCTGCCACTCCGTCTCCCGTCGTCGCTCCC
GGAGGCGCCTTCACGGGCGCGCCAGCTCAAATCACTGGTTCCGCCGTGCTTCCTCAACCGGCAGGCGCTGGTTCC
AAGGGCATCACGACATGCATCACCTTCACCACCCTCGGGCCTGACGGCAAGCCGACTGCGGTGGAGTCCACCGTC
GTGGTGCCTGCGACTCTCGTCCCCGGAGGTGTCTTCACAGGCGAGCCCTCTCAGATCACTGACTCTGCTGTCCTT
CCTCAACCGGGAGGCGCTGGTTCCCAGGGCATCACGACATGCATCACTATCACCAGTCTCGGGCCTGACGGCAAG
CCGACTGTGGTCGAGTCCACCGTGGTGGTTCCTGCCAGCAATGCCTTGCCTCCGGTCACCGTTCTAGGCCTTCCG
TCGCTCCCCCCCCCGCAGCCCTCCAACATACCTCAGGGTGCGCCTGTCTTCACGTCACTTGGCAGCCCCGTCACC
ACATGCCTCACGTTCGACGTCCTTGGACCCAATGGGGTTGCTACGCCTGTCGTTCGGACGATCGTCTTGACGCCC
GCGGCTGCTCCTAGCGCGACGACACTTGGCTACCCCTCCATCACGGCGCAGCAACAGGTGACGGATCTTCCCCAG
GGTGTTTCGCCTTCCGCCGCCGCCTATGGTGCCGTTACGACCCGCGTTACGATGTTCAGTGTGGGACCCAATGGT
GTCGCGACGCCCATTGTGCAGACTGTCGTCTTGACTCCGAGCGCCGCGGCCCTCGGCTTGCCCACTGCGCCACAG
GCTCCGAACGCCGCTGGATTCACGCTGCAGCCGCCTGGCCCGGTTGTCCAGGGCAGTCAGCCTTCCACCTTGGCA
CCGGGAGTCCCCAGCCTCGACGCCTACGGACCGGATGCGCCCAACGTTCAGAGTCCGTCGCTCCCCTCTGGCGTC
GTCTCCGGCCTCAACGTGGGAACCTTGACGGGACCGCTCACGACCGTTGTCACCCTTGTCGGCGGACAGCCGGGC
GCTTCTGGTGCCGCCGGTCTTCCCTTTCCCTACGGCGACGGCACGGGCGTCTCGGCGGCTGGTGTCGGTGCCCAA
CCCGGTGATGCCAACCACAACGGCTACGGATGGAGCCCGACCAGCGCTGGGCTCTATGGACCGCAGGCTTCGCCC
GTCGTGGCCCAGCCTCTCTTGACGGTGACGACACTTCAGACTCTCACCTGGACCAACTTCATCCCGGAGCCGACG
ACGACCTACACGATGAACTTTCCCCTGACCACGCTCGAGACGGTGGTCATTTCTGCTCCGCTCGGGAAGCGCGTG
CTCCGACGCCAGCAAAGCTCCCCGCCACTGGATCCCTCGTGGAGCAATGCCACCGCTGTCGTGCCGCCCGTCGCG
GAGAGCACCCCCATTCAGCCGGTGTTCACGCCCTTCCCGGACGTGGCCACGCCGTTGCCGGCCATTCCCATCCCG
GCGGCTTCAGTCGTGCCAAGCGTTCCCAGCTCGGGTACGGTGTGTCCATTTGGAGGCAAGATTGGCAACATGACT
GTGGATTTTGACGACGTCAAACCTGGTCCCCTGTTCAACCCTTCTGGTGACGTGTGGTTCTCGGAGGGCTTCCTC
GTGGCACCCCCAGCAGCGCAGGTTGCCCAGTCTTTTGTCCCGTCGTCAGGTGGTCAGCTTGTCGAGTTCGTGCCA
CCGTCGCTCGCCGGCATGTCCATCGGCCACCAGGGATCGGGCGACCGGGCCGAAGTGGGAGTCGGTCCCAACGCG
GCCAAGCCTTGCTTCAGGTTTGACTTCTTCAGCGCCGAGCTCGGGTGCGCCGCCACAGGCATCGAGGGATGGTGC
GAGTTCGAGGTGGCGGCCTACAGGTTCGACGCTGGCGTCTCGTTTGAGCAGTCGATTGCCTGGTCGGAGACGAAG
CGCGTGCCGGCCTGCCCCAGCTTCCCCAGCGGCACCTGCTCTCTGACGCCCGTGGCTTTTGAGGGTTACACCAAC
ATCTCGTCGGTACTCATCAACGTCCGCGTCGGCCTCGAAATGCGGGCTTGGTGGGGCGACGACTTCAAGTTTGGC
TGGACCGACAGTAGCTGCGAGGCGGCGAGCTGCCGGGCGCTGGCGGCGCCGCAGCACGTCAAGCGCGAGACTGTC
GAGCTGGCGCTTAGTCGAGGGGTCTGGCACTGGACCCCGGCCGGGCTGCAGCGGCTGGACGACGACTACATCCGG
AAGTCGGCTCAT
Transcript >Ophio5|2995
ATGGCACCCCGCGACGGACTAGTACACCCGAAAGAGTACGATATCCTCGACAGCAACGTCGAGTTCATTGGATCC
GACATGGACCATCGCGTCAAGTACAACTCGGCGGCCACAGAGCCGGCATGGAACGACGGGTCTGTAGGGCGCGAG
CCGGGACTCCGCGTCTGGCGCATCGAGCAGTTCCAGGTGGTGCCGTGGCCGAAGCAGCGCTACGGCGACTTTTAC
GACGGAGACAGTTACCTCGTGCTCCATTCGCAGCGGCCGGCCGACGCCAAGGCCGACTCGAAGAAGCTGCGGCAC
GACATCTTCTTTTGGCTGGGCAGCCACACGACCCAGGATGAGGCCGGAACAGCGGCTTACAAGACGGTCGAGCTG
GACGAGTTCCTGCACGGGGCGGCGACGCAGCATCGCGAAGTGCAGTGTGCACCGTCTGATGAGTTCCTGGCGCTG
TTTCCGCGCATGTCTATTCTGTCCGGCGGAGTGCGCTCGGGCTTCCGTCACGTCGAGGACGAGGCGGGCAAGAAA
GGCAAACAATCGAAGCGGACGCTGCTGCGCGTCTTCCAGGCCGGCGTCGGAGGCAGCGACGTCATCGTCTACGAA
GTACAGCCTACGTGGCGCAGTCTCGACGACGGCGACGTCTTCATCCTCGACGATGGCTCCAAGATATGGGTCTGG
CAAGGCCGTGGCTGCAGTCCGATGGAGAAGGCCAAAGCGGCGCAGGTGGTACACGATATGACACAAGCCAAGCAC
GTCGAAGTCGAGGTGACATCACAAGACGAGCCGCGATCGCGACGCATCGTCGACCTCCTCGGCGGCGACCAATCG
ACCCCACGCGAAGGCTTCTGCCACCCGCGGCCCATGGGCGTTTCCCCCCCGGCTGCGTCCCAGAGGCGACTGTTC
CGTCTGAGCGACGCTTCGGGTCGGCTGGAGCTTAGCCTCGTCAAGGAGGGCGGGCAGATATCTGCGGCGGACCTC
GACGGTAACGATGTCTTTCTCCTCGACGATGCGGGACGCGGACTCTGGGTCTGGGAGGGCAGGGGCTCGAGTCGT
GCCGAGAAGGCGAGGTGGTTGGCGGCGGCGCGAGCGTATGTCCAGCGTAGGCAGGAGAAGAGTGATGAGGCGTTG
GCGATGCCGGTCGCCAAGGTGGTGGAAGGGTGCGTCATGTCTTGGTCTTCTGTGTTTGTAGTGTCGGCCTTCGTC
CATTCCACGACGTCAGCGAGCCGCATCGGCATACCCTATACCCACCTGGAGGGCGCCCTACCCGCTAACACGCTC
CCACGCCGTCGTCGTCATGCCTGGAGCGTCACATGCCCGTCTCAGACTCCTCCTAGACGCGCAACAAACATCGAC
TTGAACATCAACACCGCCATGGACGGAACGATCCCCGTCAGCATCGACAGCAACGCGTGCGTCCGCTGCGTCTCT
CGACCGGCCTCGTACCTGCGCCGTGCCGTCATCGCTGGCTCGTACCCGCTGCGCGGCATCTGGTACTGCGCGCGA
GACAGCGACTTTTGGCCTCTCTTCGCTGGCAGGCTGTTGCCACTGTCCCTCATCTCCCTCGCCGTTTACTCTGTG
CTCTTTACCTTTGCCTTTTTGCCGCAATATGCCTTTATTGCAATCTTACATGGTTGGGGCGCCTGGCTTAACGCT
GTGGTTTTGACGCTCGGTGAGGGCCTGGTCATCACGCAGGCGCTGTTTGAGGGCTTCTTTGTCGACGAGTGCCGC
GTCGACGTCTTCGATGCTATCCTAATTAAGCGCGGCCTTGCCGATCTCGTCGCGCCGCACCGCCTCCTCCACGAC
GACGCGCTCAGCGCCGTCAAGATGCTCGGCAAGCCAACCAGTCCAGCCGCCTACCAACCCTGGAGCGTGATCCAG
ATTATCGAGCTCATCGTCTTCCTACCGCTCAACCTGGTACCCATTGTCGGTACGCCCGCCTTCATCATCATTACG
GGCACCCGTCTTGGCAAGTTGTCGCAATATCGCTGGTTCCAGCTCCGTGGCCTGTCGCGGCGCGAGCGCAAGCGC
GAGATTGGGGGGTTGACGTGGGATTATGTCTGTGGAGGCTCGGGTCGGGAGTGGAGGGTCTCCGCCGCCGGCCTA
TACGGACGATGTGGCCTGAAGTGGCAGGCTCCTTCCCCTAGCGTCTCCTGCTCTAGCAAGTCCCGAGACGTCGCC
GGCCTGCCGCTACAGTTCCTTCCACACATTGACGACCATGAATGGAATGACGCTTCCACCTCACCGCCCCAGCGC
AGTTTCGACCTCGAACCATCGTTCGAGGTCTTCGAACCATCGTTCGAGGCTCCTGGCGTGATACCTGCGACGCAA
GAAGTTGCCCAAGAAGTTGCCGATGACTTGGAGCCGAGGAGGAGCAGCGCTGGCTGCCTGCCCGGGCGTGGACTG
TTTGTTACCTTGGTAGGAGCGGATGCAGGCCTTAAAGACACCGTGCGGACGACTCCGAGGAGAAGGCCCCTTCTC
TGGCGTCGTTCCCGGAAACGGTCCGGCGCCGGGGAGCAAGCCTTCCTCCGGAGGCATCGCTGTCACGGCGGGCTT
TCCGTGGATCTCTGCGCCGCTGCTTTTACGCTTCCAATTGTACGCTTTTGCCGTCGTCCGCTGTTGCCTCCACGC
TGCCACCGCTACGCCCCCGATGCCTGCCATCTTCCGTGCTCTTTCTCCGCCGTACTGCGCGCTACACCGACTAAG
CCGGTGACCCGGAAGCCGTGCCTTCCTCCTCACCCCCCCTCCGTCCAACGCCTGCGCCCCAACACCTTCCAACCG
TCTCGCTGTGGCAGGAGACTCCTTCCGCGAGTGCAGTCCCGCCATGGAGCCTGCTGCTCTTCCCTCGCCAGCTTC
TCGCCTCGCCATCTGTCAGAATTCTTTCCCCCCCTCATCCTCCGTCCGCCGACCTTCGTCTCTCCTTTTCCTCAG
TCCTTTTCCCCCTTCACTCGTTTGCCCTCTAACCTATCAGCTCTACTCCCATCATCTCCTCTTCCTCGTCCTCCC
TCAGCCGTCACAACCCGCCGCAACATCGTCGTCTTTCCCCGCCTCCCCTCCGCGATGCGTGTCCTCGCGTCCGTC
GGGGTCCTGGCGGTCAGCGGCATCCTCCACGGTTCGCCTGCCCATGCAGCTGGCTATGGACCTTCCGACGGCGGC
TCTGGGGCCGAAACCTACGGCGAGCCCGGTCGTGATGGCCAAGGCGATGGCTCATCTGCCACTCTCGAGGGCTTG
CCGGCTGCGTCTGCTACCGGTCCGACATGCATGGCTGGGGCCACGACTACTGTCTTCGTCACAGTCTACCCAACT
AGTCCTGCGTCTGCCGATGACTCCGTTTCGGCTGCCGGTGCCCCTGAGCAGACTGCCCACCGCACTGTCCATGCT
TCTCCTGTTGGCCGCTCGTCATCCCACTCCGTTTCCATGTGGACCACCGTTACCTGGGATTTGTCGGGCGTTGGT
GGTTCTAACGGCATGTCTGGCTCTCCTGTCTCCGGCTCTGGTGCTGCTTCCTCCTTTGCGAACGGCGCCTCTCAC
ACCACGCAAGGCTCTCCCAATGGCGGCTACGGCGATATCACTGGCTCTTCCGCTGTTGCTGGCTGGCCAAGACCG
ACCGTCACGTCTGATACAACTGGCCCAGGCGAGAGTGGCGCCTCTGGCGATGACGCCGGATCGCCCTTCGGCACA
GGCTTGACGGCTGCCTCCGATGGATCCCCTTCTGCCTACGGTTCCGCCAATGCGGCTCAGGCCTCCCCGTCCGAT
CAAGGCCGCCACGGAGCCGGAGACAGCCCTGCTTGGCAGACTGTGGTGACGGACACCGAAGTCCACTGGGTTCCT
GGACCCTCGGGCCCGACCCCTGTCACCGTCGTTTCGGAGCACACCGTCGTTGCGGCCGGCCCCACGCAAGCTCCC
GCTGGCGGCCAACCCGTGACCTGCCTGACCACCACCGGTCCCGATGGGCGTCCGACCGTGCTTCAGTGGCCGGCT
GGAAGCCCGCAAGCCAGTGTCGGCCCCGTGGTGTCGACTGCTGGTCTGCCTGACGAAAACGGTAATGCTGGCGCC
CAGGCCTTCTCCACACTCAACGTCCCCGCCTCGGCCGGCGCAGCTTCAACGACGTGCACCACGTACACTGTCCTT
GGCACCGACGGCGTGCCCACAGTTGTCCATTCGTCTTGGCTTGTTCCCCAAGCTGGCCCTGTCACCGCCACTTCC
GGCCCTTTGCCCTCTGGCGTCTCTGGCCCGGCCTCTGCTCAGAACGCCCCCGACGGCGACGGCATCGCGACTTGC
ACCAGCGTCACCATTGTCGGACCCGATGGAAAGCCAACGGTTGTGGAATCCACCCTCGTTCTTCCCGGCACTGCG
GGCGTCCAAGGCGGAGCCCCTGGGAACCTTCCTGGCGGAAGCCCAGTCCAGGTGACCTCTCTGCTGGGCAACCCC
GGCTCTGTTCAGCCCGGTGGCAATCAACTTCCGGGAGGCGGCCACGTCACTTGCACCACTTTCACCGTCCTCGGC
GCCGATGGCCTTCCGACCGTTGTTGACACCACTTTTGTTGCTCCCGGCCCTGCCGCTACCCCCGTCACCACCATC
GCAGGCGGAGGCGTCCTGGGCGCGCCGTCTCAGACCACCGGTTCCGCCGTGCTTCCTCAACCGGGAGGCGCTGGT
TCTCAGGGCATCACGACATGCATTACCTTCACCACCCTCGGGCCTGATGGCAAGCCGACTGCGGTCGAGTCCACC
ATTGTGGTGCCTGCCACTCCGTCTCCCGTCGTCGCTCCCGGAGGCGCCTTCACGGGCGCGCCAGCTCAAATCACC
GGTTCCGCCGTGCTTCCTCAACCGGGAGGCGCTGGTTCTCAGGGCATCACGACATGCATCACCTTCACCACCCTC
GGGCCTGATGGCAAGCCGACTGCGGTCGAGTCCACCATTGTGGTGCCTGCCACTCCGTCTCCCGTCGTCGCTCCC
GGAGGCGCCTTCACGGGCGCGCCAGCTCAAATCACTGGTTCCGCCGTGCTTCCTCAACCGGCAGGCGCTGGTTCC
AAGGGCATCACGACATGCATCACCTTCACCACCCTCGGGCCTGACGGCAAGCCGACTGCGGTGGAGTCCACCGTC
GTGGTGCCTGCGACTCTCGTCCCCGGAGGTGTCTTCACAGGCGAGCCCTCTCAGATCACTGACTCTGCTGTCCTT
CCTCAACCGGGAGGCGCTGGTTCCCAGGGCATCACGACATGCATCACTATCACCAGTCTCGGGCCTGACGGCAAG
CCGACTGTGGTCGAGTCCACCGTGGTGGTTCCTGCCAGCAATGCCTTGCCTCCGGTCACCGTTCTAGGCCTTCCG
TCGCTCCCCCCCCCGCAGCCCTCCAACATACCTCAGGGTGCGCCTGTCTTCACGTCACTTGGCAGCCCCGTCACC
ACATGCCTCACGTTCGACGTCCTTGGACCCAATGGGGTTGCTACGCCTGTCGTTCGGACGATCGTCTTGACGCCC
GCGGCTGCTCCTAGCGCGACGACACTTGGCTACCCCTCCATCACGGCGCAGCAACAGGTGACGGATCTTCCCCAG
GGTGTTTCGCCTTCCGCCGCCGCCTATGGTGCCGTTACGACCCGCGTTACGATGTTCAGTGTGGGACCCAATGGT
GTCGCGACGCCCATTGTGCAGACTGTCGTCTTGACTCCGAGCGCCGCGGCCCTCGGCTTGCCCACTGCGCCACAG
GCTCCGAACGCCGCTGGATTCACGCTGCAGCCGCCTGGCCCGGTTGTCCAGGGCAGTCAGCCTTCCACCTTGGCA
CCGGGAGTCCCCAGCCTCGACGCCTACGGACCGGATGCGCCCAACGTTCAGAGTCCGTCGCTCCCCTCTGGCGTC
GTCTCCGGCCTCAACGTGGGAACCTTGACGGGACCGCTCACGACCGTTGTCACCCTTGTCGGCGGACAGCCGGGC
GCTTCTGGTGCCGCCGGTCTTCCCTTTCCCTACGGCGACGGCACGGGCGTCTCGGCGGCTGGTGTCGGTGCCCAA
CCCGGTGATGCCAACCACAACGGCTACGGATGGAGCCCGACCAGCGCTGGGCTCTATGGACCGCAGGCTTCGCCC
GTCGTGGCCCAGCCTCTCTTGACGGTGACGACACTTCAGACTCTCACCTGGACCAACTTCATCCCGGAGCCGACG
ACGACCTACACGATGAACTTTCCCCTGACCACGCTCGAGACGGTGGTCATTTCTGCTCCGCTCGGGAAGCGCGTG
CTCCGACGCCAGCAAAGCTCCCCGCCACTGGATCCCTCGTGGAGCAATGCCACCGCTGTCGTGCCGCCCGTCGCG
GAGAGCACCCCCATTCAGCCGGTGTTCACGCCCTTCCCGGACGTGGCCACGCCGTTGCCGGCCATTCCCATCCCG
GCGGCTTCAGTCGTGCCAAGCGTTCCCAGCTCGGGTACGGTGTGTCCATTTGGAGGCAAGATTGGCAACATGACT
GTGGATTTTGACGACGTCAAACCTGGTCCCCTGTTCAACCCTTCTGGTGACGTGTGGTTCTCGGAGGGCTTCCTC
GTGGCACCCCCAGCAGCGCAGGTTGCCCAGTCTTTTGTCCCGTCGTCAGGTGGTCAGCTTGTCGAGTTCGTGCCA
CCGTCGCTCGCCGGCATGTCCATCGGCCACCAGGGATCGGGCGACCGGGCCGAAGTGGGAGTCGGTCCCAACGCG
GCCAAGCCTTGCTTCAGGTTTGACTTCTTCAGCGCCGAGCTCGGGTGCGCCGCCACAGGCATCGAGGGATGGTGC
GAGTTCGAGGTGGCGGCCTACAGGTTCGACGCTGGCGTCTCGTTTGAGCAGTCGATTGCCTGGTCGGAGACGAAG
CGCGTGCCGGCCTGCCCCAGCTTCCCCAGCGGCACCTGCTCTCTGACGCCCGTGGCTTTTGAGGGTTACACCAAC
ATCTCGTCGGTACTCATCAACGTCCGCGTCGGCCTCGAAATGCGGGCTTGGTGGGGCGACGACTTCAAGTTTGGC
TGGACCGACAGTAGCTGCGAGGCGGCGAGCTGCCGGGCGCTGGCGGCGCCGCAGCACGTCAAGCGCGAGACTGTC
GAGCTGGCGCTTAGTCGAGGGGTCTGGCACTGGACCCCGGCCGGGCTGCAGCGGCTGGACGACGACTACATCCGG
AAGTCGGCTCATTGA
Gene >Ophio5|2995
ATGGCACCCCGCGACGGACTAGTACACCCGAAAGAGTACGATATCCTCGACAGCAACGTCGAGTTCATTGGATCC
GACATGGACCATCGCGTCAAGTACAACTCGGCGGCCACAGAGCCGGCATGGAACGACGGGTCTGTAGGGCGCGAG
CCGGGACTCCGCGTCTGGCGCATCGAGCAGTTCCAGGTGGTGCCGTGGCCGAAGCAGCGCTACGGCGACTTTTAC
GACGGAGACAGTTACCTCGTGCTCCATTCGCAGCGGCCGGCCGACGCCAAGGCCGACTCGAAGAAGCTGCGGCAC
GACATCTTCTTTTGGCTGGGCAGCCACACGACCCAGGATGAGGCCGGAACAGCGGCTTACAAGACGGTCGAGCTG
GACGAGTTCCTGCACGGGGCGGCGACGCAGCATCGCGAAGTGCAGTGTGCACCGTCTGATGAGTTCCTGGCGCTG
TTTCCGCGCATGTCTATTCTGTCCGGCGGAGTGCGCTCGGGCTTCCGTCACGTCGAGGACGAGGCGGGCAAGAAA
GGCAAACAATCGAAGCGGACGCTGCTGCGCGTCTTCCAGGCCGGCGTCGGAGGCAGCGACGTCATCGTCTACGAA
GTACAGCCTACGTGGCGCAGTCTCGACGACGGCGACGTCTTCATCCTCGACGATGGCTCCAAGATATGGGTCTGG
CAAGGCCGTGGCTGCAGTCCGATGGAGAAGGCCAAAGCGGCGCAGGTGGTACACGATATGACACAAGCCAAGCAC
GTCGAAGTCGAGGTGACATCACAAGACGAGCCGCGATCGCGACGCATCGTCGACCTCCTCGGCGGCGACCAATCG
ACCCCACGCGAAGGCTTCTGCCACCCGCGGCCCATGGGCGTTTCCCCCCCGGCTGCGTCCCAGAGGCGACTGTTC
CGTCTGAGCGACGCTTCGGGTCGGCTGGAGCTTAGCCTCGTCAAGGAGGGCGGGCAGATATCTGCGGCGGACCTC
GACGGTAACGATGTCTTTCTCCTCGACGATGCGGGACGCGGACTCTGGGTCTGGGAGGGCAGGGGCTCGAGTCGT
GCCGAGAAGGCGAGGTGGTTGGCGGCGGCGCGAGCGTATGTCCAGCGTAGGCAGGAGAAGAGTGATGAGGCGTTG
GCGATGCCGGTCGCCAAGGTGGTGGAAGGGTGTGAGAGCCCGGCGTTTCTGAGGGCGATTGAGGCTCGCTGATGG
GGGGACAGATGCTTTCCGGAGAGATTGGTTCGAAGCTTATCTTTAGTATTTTCCCTACTTTTCCATCCCATAAGG
CTGGAATTTCGACTGCAGGCGTCATGTCTTGGTCTTCTGTGTTTGTAGTGTCGGCCTTCGTCCATTCCACGACGT
CAGCGAGCCGCATCGGCATACCCTATACCCACCTGGAGGGCGCCCTACCCGCTAACACGCTCCCACGCCGTCGTC
GTCATGCCTGGAGCGTCACATGCCCGTCTCAGACTCCTCCTAGACGCGCAACAAACATCGACTTGAACATCAACA
CCGCCATGGACGGAACGATCCCCGTCAGCATCGACAGCAACGCGTGCGTCCGCTGCGTCTCTCGACCGGCCTCGT
ACCTGCGCCGTGCCGTCATCGCTGGCTCGTACCCGCTGCGCGGCATCTGGTACTGCGCGCGAGACAGCGACTTTT
GGCCTCTCTTCGCTGGCAGGCTGTTGCCACTGTCCCTCATCTCCCTCGCCGTTTACTCTGTGCTCTTTACCTTTG
CCTTTTTGCCGCAATATGCCTTTATTGCAATCTTACATGGTTGGGGCGCCTGGCTTAACGCTGTGGTTTTGACGC
TCGGTGAGGGCCTGGTCATCACGCAGGCGCTGTTTGAGGGCTTCTTTGTCGACGAGTGCCGCGTCGACGTCTTCG
ATGTGCGTAAATCACGCATCTACACTGTAACATCGCACCTATTGACCTCAAACAACACACAGGCTATCCTAATTA
AGCGCGGCCTTGCCGATCTCGTCGCGCCGCACCGCCTCCTCCACGACGACGCGCTCAGCGCCGTCAAGATGCTCG
GCAAGCCAACCAGTCCAGCCGCCTACCAACCCTGGAGCGTGATCCAGATTATCGAGCTCATCGTCTTCCTACCGC
TCAACCTGGTACCCATTGTCGGTACGCCCGCCTTCATCATCATTACGGGCACCCGTCTTGGCAAGTTGTCGCAAT
ATCGCTGGTTCCAGCTCCGTGGCCTGTCGCGGCGCGAGCGCAAGCGCGAGATTGGGGGGTTGACGTGGGATTATG
TCTGGTTTGGCACGGTTGCTATGCTGTTGGAGCTGGTGCCGCTGTTGTCGTTCTTTTTTCTGCTTACTACCTCGG
CTGGGTCTGCCGCTTGGGCGGCGGCCATGGAGCATCGTCGGAGGCATGCTGCTCGGGCCGCAGTGGAGGCTCGGG
TCGGGAGTGGAGGGTCTCCGCCGCCGGCCTATACGGACGATGTGGCCTGAAGTGGCAGGCGAGTCTCCCACAGCA
TTCATCTCCTGCCAGCGCCGTCTCTGTTGCTGTCGCTCTTCCTCCGCCTCATCACCTTTCTCACTTGGGCTCTCT
TCCTCTTTACCCACCTACTCACCCCTCTCTCTCCTCTCTCCAGGCTCCTTCCCCTAGCGTCTCCTGCTCTAGCAA
GTCCCGAGACGTCGCCGGCCTGCCGCTACAGTTCCTTCCACACATTGACGACCATGAATGGAATGACGCTTCCAC
CTCACCGCCCCAGCGCAGTTTCGACCTCGAACCATCGTTCGAGGTCTTCGAACCATCGTTCGAGGCTCCTGGCGT
GATACCTGCGACGTGCGGCCCCCAGAGAAGGAGTTGGAGAAAGAGCCGGCGGACTCACCGCCCCCGCGGAGCATC
GGCGAATACTGCGCAGGCAAGAAGTTGCCCAAGAAGTTGCCGATGACTTGGAGCCGAGGAGGAGCAGCGCTGGCT
GCCTGCCCGGGCGTGGACTGTTTGTTACCTTGGTAGGAGCGGATGCAGGCCTTAAAGACACCGTGCGGACGACTC
CGAGGAGAAGGCCCCTTCTCTGGCGTCGTTCCCGGAAACGGTCCGGCGCCGGGGAGCAAGCCTTCCTCCGGAGGC
ATCGCTGTCACGGCGGGCTTTCCGTGGATCTCTGCGCCGCTGCTTTTACGCTTCCAATTGTACGCTTTTGCCGTC
GTCCGCTGTTGCCTCCACGCTGCCACCGCTACGCCCCCGATGCCTGCCATCTTCCGTGCTCTTTCTCCGCCGTAC
TGCGCGCTACACCGACTAAGCCGGTGACCCGGAAGCCGTGCCTTCCTCCTCACCCCCCCTCCGTCCAACGCCTGC
GCCCCAACACCTTCCAACCGTCTCGCTGTGGCAGGAGACTCCTTCCGCGAGTGCAGTCCCGCCATGGAGCCTGCT
GCTCTTCCCTCGCCAGCTTCTCGCCTCGCCATCTGTCAGAATTCTTTCCCCCCCTCATCCTCCGTCCGCCGACCT
TCGTCTCTCCTTTTCCTCAGTCCTTTTCCCCCTTCACTCGTTTGCCCTCTAACCTATCAGCTCTACTCCCATCAT
CTCCTCTTCCTCGTCCTCCCTCAGCCGTCACAACCCGCCGCAACATCGTCGTCTTTCCCCGCCTCCCCTCCGCGA
TGCGTGTCCTCGCGTCCGTCGGGGTCCTGGCGGTCAGCGGCATCCTCCACGGTTCGCCTGCCCATGCAGCTGGCT
ATGGGTGAGAGCTCATTCGGAATTCCCGTGCCTGGGGCATCGCTTTGCTGACGCCGCTGCTCAGACCTTCCGACG
GCGGCTCTGGGGCCGAAACCTACGGCGAGCCCGGTCGTGATGGCCAAGGCGATGGCTCATCTGCCACTCTCGAGG
GCTTGCCGGCTGCGTCTGCTACCGGTCCGACATGCATGGCTGGGGCCACGACTACTGTCTTCGTCACAGTCTACC
CAACTAGTCCTGCGTCTGCCGATGACTCCGTTTCGGCTGCCGGTGCCCCTGAGCAGACTGCCCACCGCACTGTCC
ATGCTTCTCCTGTTGGCCGCTCGTCATCCCACTCCGTTTCCATGTGGACCACCGTTACCTGGGATTTGTCGGGCG
TTGGTGGTTCTAACGGCATGTCTGGCTCTCCTGTCTCCGGCTCTGGTGCTGCTTCCTCCTTTGCGAACGGCGCCT
CTCACACCACGCAAGGCTCTCCCAATGGCGGCTACGGCGATATCACTGGCTCTTCCGCTGTTGCTGGCTGGCCAA
GACCGACCGTCACGTCTGATACAACTGGCCCAGGCGAGAGTGGCGCCTCTGGCGATGACGCCGGATCGCCCTTCG
GCACAGGCTTGACGGCTGCCTCCGATGGATCCCCTTCTGCCTACGGTTCCGCCAATGCGGCTCAGGCCTCCCCGT
CCGATCAAGGCCGCCACGGAGCCGGAGACAGCCCTGCTTGGCAGACTGTGGTGACGGACACCGAAGTCCACTGGG
TTCCTGGACCCTCGGGCCCGACCCCTGTCACCGTCGTTTCGGAGCACACCGTCGTTGCGGCCGGCCCCACGCAAG
CTCCCGCTGGCGGCCAACCCGTGACCTGCCTGACCACCACCGGTCCCGATGGGCGTCCGACCGTGCTTCAGTGGC
CGGCTGGAAGCCCGCAAGCCAGTGTCGGCCCCGTGGTGTCGACTGCTGGTCTGCCTGACGAAAACGGTAATGCTG
GCGCCCAGGCCTTCTCCACACTCAACGTCCCCGCCTCGGCCGGCGCAGCTTCAACGACGTGCACCACGTACACTG
TCCTTGGCACCGACGGCGTGCCCACAGTTGTCCATTCGTCTTGGCTTGTTCCCCAAGCTGGCCCTGTCACCGCCA
CTTCCGGCCCTTTGCCCTCTGGCGTCTCTGGCCCGGCCTCTGCTCAGAACGCCCCCGACGGCGACGGCATCGCGA
CTTGCACCAGCGTCACCATTGTCGGACCCGATGGAAAGCCAACGGTTGTGGAATCCACCCTCGTTCTTCCCGGCA
CTGCGGGCGTCCAAGGCGGAGCCCCTGGGAACCTTCCTGGCGGAAGCCCAGTCCAGGTGACCTCTCTGCTGGGCA
ACCCCGGCTCTGTTCAGCCCGGTGGCAATCAACTTCCGGGAGGCGGCCACGTCACTTGCACCACTTTCACCGTCC
TCGGCGCCGATGGCCTTCCGACCGTTGTTGACACCACTTTTGTTGCTCCCGGCCCTGCCGCTACCCCCGTCACCA
CCATCGCAGGCGGAGGCGTCCTGGGCGCGCCGTCTCAGACCACCGGTTCCGCCGTGCTTCCTCAACCGGGAGGCG
CTGGTTCTCAGGGCATCACGACATGCATTACCTTCACCACCCTCGGGCCTGATGGCAAGCCGACTGCGGTCGAGT
CCACCATTGTGGTGCCTGCCACTCCGTCTCCCGTCGTCGCTCCCGGAGGCGCCTTCACGGGCGCGCCAGCTCAAA
TCACCGGTTCCGCCGTGCTTCCTCAACCGGGAGGCGCTGGTTCTCAGGGCATCACGACATGCATCACCTTCACCA
CCCTCGGGCCTGATGGCAAGCCGACTGCGGTCGAGTCCACCATTGTGGTGCCTGCCACTCCGTCTCCCGTCGTCG
CTCCCGGAGGCGCCTTCACGGGCGCGCCAGCTCAAATCACTGGTTCCGCCGTGCTTCCTCAACCGGCAGGCGCTG
GTTCCAAGGGCATCACGACATGCATCACCTTCACCACCCTCGGGCCTGACGGCAAGCCGACTGCGGTGGAGTCCA
CCGTCGTGGTGCCTGCGACTCTCGTCCCCGGAGGTGTCTTCACAGGCGAGCCCTCTCAGATCACTGACTCTGCTG
TCCTTCCTCAACCGGGAGGCGCTGGTTCCCAGGGCATCACGACATGCATCACTATCACCAGTCTCGGGCCTGACG
GCAAGCCGACTGTGGTCGAGTCCACCGTGGTGGTTCCTGCCAGCAATGCCTTGCCTCCGGTCACCGTTCTAGGCC
TTCCGTCGCTCCCCCCCCCGCAGCCCTCCAACATACCTCAGGGTGCGCCTGTCTTCACGTCACTTGGCAGCCCCG
TCACCACATGCCTCACGTTCGACGTCCTTGGACCCAATGGGGTTGCTACGCCTGTCGTTCGGACGATCGTCTTGA
CGCCCGCGGCTGCTCCTAGCGCGACGACACTTGGCTACCCCTCCATCACGGCGCAGCAACAGGTGACGGATCTTC
CCCAGGGTGTTTCGCCTTCCGCCGCCGCCTATGGTGCCGTTACGACCCGCGTTACGATGTTCAGTGTGGGACCCA
ATGGTGTCGCGACGCCCATTGTGCAGACTGTCGTCTTGACTCCGAGCGCCGCGGCCCTCGGCTTGCCCACTGCGC
CACAGGCTCCGAACGCCGCTGGATTCACGCTGCAGCCGCCTGGCCCGGTTGTCCAGGGCAGTCAGCCTTCCACCT
TGGCACCGGGAGTCCCCAGCCTCGACGCCTACGGACCGGATGCGCCCAACGTTCAGAGTCCGTCGCTCCCCTCTG
GCGTCGTCTCCGGCCTCAACGTGGGAACCTTGACGGGACCGCTCACGACCGTTGTCACCCTTGTCGGCGGACAGC
CGGGCGCTTCTGGTGCCGCCGGTCTTCCCTTTCCCTACGGCGACGGCACGGGCGTCTCGGCGGCTGGTGTCGGTG
CCCAACCCGGTGATGCCAACCACAACGGCTACGGATGGAGCCCGACCAGCGCTGGGCTCTATGGACCGCAGGCTT
CGCCCGTCGTGGCCCAGCCTCTCTTGACGGTGACGACACTTCAGACTCTCACCTGGACCAACTTCATCCCGGAGC
CGACGACGACCTACACGATGAACTTTCCCCTGACCACGCTCGAGACGGTGGTCATTTCTGCTCCGCTCGGGAAGC
GCGTGCTCCGACGCCAGCAAAGGTATGTCGCGTCCTCCCTCTTCTACTCTGTCAATGACTGACATTGATGCACAG
CTCCCCGCCACTGGATCCCTCGTGGAGCAATGCCACCGCTGTCGTGCCGCCCGTCGCGGAGAGCACCCCCATTCA
GCCGGTGTTCACGCCCTTCCCGGACGTGGCCACGCCGTTGCCGGCCATTCCCATCCCGGCGGCTTCAGTCGTGCC
AAGCGTTCCCAGCTCGGGTACGGTGTGTCCATTTGGAGGCAAGATTGGCAACATGACTGTGGATGTGAGTGTCAC
GGCTCGGCGTAGACTTGGCAGGACTTTGGCTGACCCGCGCAGTTTGACGACGTCAAACCTGGTCCCCTGTTCAAC
CCTTCTGGTGACGTGTGGTTCTCGGAGGGCTTCCTCGTGGCACCCCCAGCAGCGCAGGTTGCCCAGTCTTTTGTC
CCGTCGTCAGGTGGTCAGCTTGTCGAGTTCGTGCCACCGTCGCTCGCCGGCATGTCCATCGGCCACCAGGGATCG
GGCGACCGGGCCGAAGTGGGAGTCGGTCCCAACGCGGCCAAGCCTTGCTTCAGGTTTGACTTCTTCAGCGCCGAG
CTCGGGTGCGCCGCCACAGGCATCGAGGGATGGTGCGAGTTCGAGGTGGCGGCCTACAGGTTCGACGCTGGCGTC
TCGTTTGAGCAGTCGATTGCCTGGTCGGAGACGAAGCGCGTGCCGGCCTGCCCCAGCTTCCCCAGCGGCACCTGC
TCTCTGACGCCCGTGGCTTTTGAGGGTTACACCAACATCTCGTCGGTACTCATCAACGTCCGCGTCGGCCTCGAA
ATGCGGGCTTGGTGGGGCGACGACTTCAAGTTTGGCTGGACCGACAGTAGCTGCGAGGCGGCGAGCTGCCGGGCG
CTGGCGGCGCCGCAGCACGTCAAGCGCGAGACTGTCGAGCTGGCGCTTAGTCGAGGGGTCTGGCACTGGACCCCG
GCCGGGCTGCAGCGGCTGGACGACGACTACATCCGGAAGTCGGCTCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail