Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2989
Gene name
Locationscaffold_239:725..1112
Strand+
Gene length (bp)387
Transcript length (bp)225
Coding sequence length (bp)222
Protein length (aa) 74

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10685 KGG Stress-induced bacterial acidophilic repeat motif 4.3E-12 9 30
PF10685 KGG Stress-induced bacterial acidophilic repeat motif 2.9E-09 33 54

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P10713|CON10_NEUCR Conidiation-specific protein 10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=con-10 PE=2 SV=1 2 74 2.0E-36

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2989
MTDNTNPGNFANRPKEEVQEIASKGGQSSHSGGFASMDADKQRDIASKGGKSSSGSFEPGSEKAKEAGRKGGSA
Coding >Ophio5|2989
ATGACTGACAACACCAACCCCGGAAACTTTGCCAACCGCCCCAAGGAGGAGGTACAGGAGATTGCCTCCAAGGGC
GGCCAGTCGAGCCACAGCGGCGGCTTCGCGTCCATGGACGCGGATAAGCAGCGCGATATTGCTTCCAAGGGCGGC
AAGAGCTCCTCTGGCTCGTTTGAACCGGGAAGTGAGAAAGCGAAGGAGGCAGGCCGGAAGGGGGGTTCGGCT
Transcript >Ophio5|2989
ATGACTGACAACACCAACCCCGGAAACTTTGCCAACCGCCCCAAGGAGGAGGTACAGGAGATTGCCTCCAAGGGC
GGCCAGTCGAGCCACAGCGGCGGCTTCGCGTCCATGGACGCGGATAAGCAGCGCGATATTGCTTCCAAGGGCGGC
AAGAGCTCCTCTGGCTCGTTTGAACCGGGAAGTGAGAAAGCGAAGGAGGCAGGCCGGAAGGGGGGTTCGGCTTGA
Gene >Ophio5|2989
ATGACTGACAACACCAACCCCGGAAACTTTGCCAACCGGTATCTCTCTTCCTCCTCGGGTCCCCCCCCCCCCTTT
TACCCTTTGTTTTTCCCTTCCCACTTTTACTGATGTCAGTCAGCCCCAAGGAGGAGGTACAGGAGATTGCCTCCA
AGGGCGGCCAGTCGAGCCACAGCGGCGGCTTCGCGTCCATGGACGCGGATAAGCAGGTAGAGTTTCCCCATGCGT
CGTCCCCCCCCGATACGAGGGGGGAAGGGGGGAAAGGATTTTTAATGCGTGCGAGTTGTGTAGCGCGATATTGCT
TCCAAGGGCGGCAAGAGCTCCTCTGGCTCGTTTGAACCGGGAAGTGAGAAAGCGAAGGAGGCAGGCCGGAAGGGG
GGTTCGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail