Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2985
Gene name
Locationscaffold_238:15095..16625
Strand-
Gene length (bp)1530
Transcript length (bp)1359
Coding sequence length (bp)1356
Protein length (aa) 452

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05193 Peptidase_M16_C Peptidase M16 inactive domain 6.0E-12 194 372
PF00675 Peptidase_M16 Insulinase (Peptidase family M16) 9.0E-12 43 183

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60044|QCR2_NEUCR Cytochrome b-c1 complex subunit 2, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qcr-2 PE=2 SV=2 1 452 1.0E-162
sp|P78761|QCR2_SCHPO Cytochrome b-c1 complex subunit 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr2 PE=2 SV=2 16 448 4.0E-66
sp|Q6C2E3|QCR2_YARLI Cytochrome b-c1 complex subunit 2, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=QCR2 PE=3 SV=1 33 448 1.0E-60
sp|P83782|QCR2_CANAL Cytochrome b-c1 complex subunit 2, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QCR2 PE=1 SV=2 39 448 8.0E-34
sp|Q75CW5|QCR2_ASHGO Cytochrome b-c1 complex subunit 2, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=QCR2 PE=3 SV=2 41 273 2.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60044|QCR2_NEUCR Cytochrome b-c1 complex subunit 2, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qcr-2 PE=2 SV=2 1 452 1.0E-162
sp|P78761|QCR2_SCHPO Cytochrome b-c1 complex subunit 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr2 PE=2 SV=2 16 448 4.0E-66
sp|Q6C2E3|QCR2_YARLI Cytochrome b-c1 complex subunit 2, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=QCR2 PE=3 SV=1 33 448 1.0E-60
sp|P83782|QCR2_CANAL Cytochrome b-c1 complex subunit 2, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QCR2 PE=1 SV=2 39 448 8.0E-34
sp|Q75CW5|QCR2_ASHGO Cytochrome b-c1 complex subunit 2, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=QCR2 PE=3 SV=2 41 273 2.0E-31
sp|Q6BPY6|QCR2_DEBHA Cytochrome b-c1 complex subunit 2, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=QCR2 PE=3 SV=1 41 357 2.0E-28
sp|P07257|QCR2_YEAST Cytochrome b-c1 complex subunit 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR2 PE=1 SV=1 33 448 2.0E-28
sp|Q6CWJ6|QCR2_KLULA Cytochrome b-c1 complex subunit 2, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=QCR2 PE=3 SV=1 43 380 9.0E-27
sp|Q6FSJ3|QCR2_CANGA Cytochrome b-c1 complex subunit 2, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=QCR2 PE=3 SV=1 43 376 4.0E-25
sp|P22695|QCR2_HUMAN Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens GN=UQCRC2 PE=1 SV=3 39 448 2.0E-24
sp|Q9DB77|QCR2_MOUSE Cytochrome b-c1 complex subunit 2, mitochondrial OS=Mus musculus GN=Uqcrc2 PE=1 SV=1 39 448 3.0E-24
sp|P32551|QCR2_RAT Cytochrome b-c1 complex subunit 2, mitochondrial OS=Rattus norvegicus GN=Uqcrc2 PE=1 SV=2 39 448 6.0E-23
sp|P23004|QCR2_BOVIN Cytochrome b-c1 complex subunit 2, mitochondrial OS=Bos taurus GN=UQCRC2 PE=1 SV=2 39 448 9.0E-23
sp|Q9ZU25|MPPA1_ARATH Probable mitochondrial-processing peptidase subunit alpha-1 OS=Arabidopsis thaliana GN=At1g51980 PE=2 SV=1 39 451 4.0E-18
sp|Q54F93|MPPA2_DICDI Mitochondrial-processing peptidase subunit alpha-2 OS=Dictyostelium discoideum GN=mppA2 PE=1 SV=1 39 439 1.0E-16
sp|P29677|MPPA_SOLTU Mitochondrial-processing peptidase subunit alpha OS=Solanum tuberosum GN=MPP PE=1 SV=1 16 446 7.0E-16
sp|P11914|MPPA_YEAST Mitochondrial-processing peptidase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAS2 PE=1 SV=1 21 438 1.0E-14
sp|Q3SZ71|MPPB_BOVIN Mitochondrial-processing peptidase subunit beta OS=Bos taurus GN=PMPCB PE=2 SV=1 39 369 4.0E-14
sp|O04308|MPPA2_ARATH Probable mitochondrial-processing peptidase subunit alpha-2 OS=Arabidopsis thaliana GN=MPPA2 PE=1 SV=1 39 448 8.0E-14
sp|O75439|MPPB_HUMAN Mitochondrial-processing peptidase subunit beta OS=Homo sapiens GN=PMPCB PE=1 SV=2 39 369 1.0E-13
sp|Q5REK3|MPPB_PONAB Mitochondrial-processing peptidase subunit beta OS=Pongo abelii GN=PMPCB PE=2 SV=1 39 369 2.0E-13
sp|Q9CXT8|MPPB_MOUSE Mitochondrial-processing peptidase subunit beta OS=Mus musculus GN=Pmpcb PE=1 SV=1 39 369 2.0E-13
sp|P43264|QCR1_EUGGR Ubiquinol-cytochrome-c reductase complex core protein I, mitochondrial OS=Euglena gracilis PE=2 SV=1 39 309 2.0E-12
sp|Q03346|MPPB_RAT Mitochondrial-processing peptidase subunit beta OS=Rattus norvegicus GN=Pmpcb PE=1 SV=3 39 369 4.0E-12
sp|P23955|MPPA_NEUCR Mitochondrial-processing peptidase subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mpp PE=1 SV=2 39 243 5.0E-12
sp|Q9Y8B5|MPPB_LENED Mitochondrial-processing peptidase subunit beta OS=Lentinula edodes GN=mppB PE=3 SV=1 7 241 1.0E-11
sp|Q68FY0|QCR1_RAT Cytochrome b-c1 complex subunit 1, mitochondrial OS=Rattus norvegicus GN=Uqcrc1 PE=1 SV=1 6 342 8.0E-11
sp|Q9CZ13|QCR1_MOUSE Cytochrome b-c1 complex subunit 1, mitochondrial OS=Mus musculus GN=Uqcrc1 PE=1 SV=2 39 342 4.0E-10
sp|Q42290|MPPB_ARATH Probable mitochondrial-processing peptidase subunit beta OS=Arabidopsis thaliana GN=At3g02090 PE=2 SV=2 39 443 4.0E-10
sp|Q86A84|MPPA1_DICDI Mitochondrial-processing peptidase subunit alpha-1 OS=Dictyostelium discoideum GN=mppA1 PE=1 SV=1 39 237 1.0E-09
sp|P31800|QCR1_BOVIN Cytochrome b-c1 complex subunit 1, mitochondrial OS=Bos taurus GN=UQCRC1 PE=1 SV=2 39 219 3.0E-09
sp|P31930|QCR1_HUMAN Cytochrome b-c1 complex subunit 1, mitochondrial OS=Homo sapiens GN=UQCRC1 PE=1 SV=3 39 219 3.0E-08
sp|Q4W6B5|MPPB_DICDI Mitochondrial-processing peptidase subunit beta OS=Dictyostelium discoideum GN=mppB PE=1 SV=1 39 242 3.0E-08
sp|Q10713|MPPA_HUMAN Mitochondrial-processing peptidase subunit alpha OS=Homo sapiens GN=PMPCA PE=1 SV=2 19 443 3.0E-08
sp|P11913|MPPB_NEUCR Mitochondrial-processing peptidase subunit beta OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pep PE=1 SV=1 21 240 2.0E-07
sp|Q5R513|MPPA_PONAB Mitochondrial-processing peptidase subunit alpha OS=Pongo abelii GN=PMPCA PE=2 SV=2 19 443 2.0E-07
sp|O94745|MPPA_SCHPO Probable mitochondrial-processing peptidase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mas2 PE=3 SV=2 55 256 5.0E-07
sp|Q9DC61|MPPA_MOUSE Mitochondrial-processing peptidase subunit alpha OS=Mus musculus GN=Pmpca PE=1 SV=1 19 443 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2985
MISRSALARHAQQAARLSLPRRGFAAAASTGAFETSEISGLRVASRDVHGPTTKLAVIVKAGTRYQPLPGLTVGL
GEFAFKTTQRRSALRIQRESELLGGQLAVSHTREVLLLEASFLREDLPFFTELLAEVVSMTKYTTHELHEDVERV
LPLKQAALQADASSLALDHAHAVAFHTGLGAPIYPSSLAPYRKYLNEEYIASYADLVYSKPNFTVVADGASPTNM
SKWISQFFANVPASSQSGQTLKVEASKYHGGEQRTDHAGGNSMVIAFPGSDMAGSKPEIPVLASLLGGKPTIKWA
PGFSLLCKACAGLPNLSVSASNMAYSDAGLMAVQLSGSASSVRKAAEATAQALKSIAGGSVKKENVSRAVANAKF
EALDRAQLRDNGILLTGSGIVTRGKPSDMTELVRGFDSVTYEKVIATAKSLLGGKATVSTAGDLFVLPYADELGF
KV
Coding >Ophio5|2985
ATGATTTCGAGATCCGCGCTCGCAAGACACGCGCAGCAGGCAGCTCGGCTCTCCTTGCCGCGTCGTGGCTTTGCC
GCCGCTGCCTCGACGGGAGCTTTCGAAACTTCGGAGATATCCGGTCTGAGAGTCGCTTCGAGGGATGTCCATGGC
CCGACGACGAAGCTGGCCGTCATTGTCAAGGCCGGCACCCGATATCAACCTTTGCCCGGCCTGACTGTTGGCCTG
GGAGAGTTCGCCTTCAAGACCACGCAGAGACGATCTGCTCTTCGTATACAGCGCGAGTCCGAGCTTCTCGGCGGT
CAATTGGCTGTCTCGCACACCCGCGAGGTCCTCCTCCTTGAGGCCAGCTTCCTCCGCGAGGATCTGCCCTTCTTC
ACCGAACTGCTGGCCGAGGTCGTGTCCATGACCAAGTATACGACACACGAGCTTCACGAAGACGTCGAGAGGGTG
CTACCTCTTAAGCAGGCCGCTTTGCAGGCAGACGCTTCTTCTCTTGCCCTCGACCACGCACACGCGGTCGCCTTC
CATACCGGTCTCGGTGCCCCCATATACCCTTCCTCTTTGGCGCCGTATCGCAAGTACCTAAACGAGGAGTACATT
GCCAGCTATGCCGACCTCGTCTACTCGAAGCCCAACTTTACCGTCGTGGCGGACGGTGCGTCGCCGACCAATATG
TCCAAGTGGATCAGCCAGTTCTTTGCAAACGTGCCCGCCTCTTCTCAGAGCGGCCAGACGCTCAAGGTCGAAGCG
TCAAAATACCACGGCGGTGAGCAGCGGACAGACCACGCCGGCGGAAATTCGATGGTCATTGCCTTTCCGGGCTCC
GACATGGCCGGCTCAAAACCCGAAATTCCCGTTCTGGCGTCGCTGCTCGGCGGCAAGCCTACGATCAAATGGGCC
CCTGGCTTCAGCCTGCTCTGCAAGGCCTGTGCCGGGTTGCCCAACCTCTCCGTTTCGGCGTCGAACATGGCCTAT
TCCGACGCGGGTCTGATGGCCGTTCAGCTGTCCGGTAGCGCCTCGTCCGTACGAAAGGCAGCCGAGGCCACTGCC
CAGGCACTCAAGTCCATCGCGGGCGGTTCGGTCAAGAAGGAAAACGTGAGCAGGGCCGTTGCCAACGCCAAATTT
GAGGCCTTGGACCGCGCTCAACTGCGGGATAACGGCATACTACTGACCGGATCCGGAATTGTGACCAGAGGCAAG
CCCTCGGACATGACTGAATTGGTCCGTGGCTTCGACTCCGTTACTTACGAGAAGGTGATTGCGACAGCCAAGTCT
CTCCTGGGCGGCAAGGCGACGGTGTCTACCGCTGGAGACCTGTTTGTGCTGCCGTATGCCGATGAGCTGGGATTC
AAGGTC
Transcript >Ophio5|2985
ATGATTTCGAGATCCGCGCTCGCAAGACACGCGCAGCAGGCAGCTCGGCTCTCCTTGCCGCGTCGTGGCTTTGCC
GCCGCTGCCTCGACGGGAGCTTTCGAAACTTCGGAGATATCCGGTCTGAGAGTCGCTTCGAGGGATGTCCATGGC
CCGACGACGAAGCTGGCCGTCATTGTCAAGGCCGGCACCCGATATCAACCTTTGCCCGGCCTGACTGTTGGCCTG
GGAGAGTTCGCCTTCAAGACCACGCAGAGACGATCTGCTCTTCGTATACAGCGCGAGTCCGAGCTTCTCGGCGGT
CAATTGGCTGTCTCGCACACCCGCGAGGTCCTCCTCCTTGAGGCCAGCTTCCTCCGCGAGGATCTGCCCTTCTTC
ACCGAACTGCTGGCCGAGGTCGTGTCCATGACCAAGTATACGACACACGAGCTTCACGAAGACGTCGAGAGGGTG
CTACCTCTTAAGCAGGCCGCTTTGCAGGCAGACGCTTCTTCTCTTGCCCTCGACCACGCACACGCGGTCGCCTTC
CATACCGGTCTCGGTGCCCCCATATACCCTTCCTCTTTGGCGCCGTATCGCAAGTACCTAAACGAGGAGTACATT
GCCAGCTATGCCGACCTCGTCTACTCGAAGCCCAACTTTACCGTCGTGGCGGACGGTGCGTCGCCGACCAATATG
TCCAAGTGGATCAGCCAGTTCTTTGCAAACGTGCCCGCCTCTTCTCAGAGCGGCCAGACGCTCAAGGTCGAAGCG
TCAAAATACCACGGCGGTGAGCAGCGGACAGACCACGCCGGCGGAAATTCGATGGTCATTGCCTTTCCGGGCTCC
GACATGGCCGGCTCAAAACCCGAAATTCCCGTTCTGGCGTCGCTGCTCGGCGGCAAGCCTACGATCAAATGGGCC
CCTGGCTTCAGCCTGCTCTGCAAGGCCTGTGCCGGGTTGCCCAACCTCTCCGTTTCGGCGTCGAACATGGCCTAT
TCCGACGCGGGTCTGATGGCCGTTCAGCTGTCCGGTAGCGCCTCGTCCGTACGAAAGGCAGCCGAGGCCACTGCC
CAGGCACTCAAGTCCATCGCGGGCGGTTCGGTCAAGAAGGAAAACGTGAGCAGGGCCGTTGCCAACGCCAAATTT
GAGGCCTTGGACCGCGCTCAACTGCGGGATAACGGCATACTACTGACCGGATCCGGAATTGTGACCAGAGGCAAG
CCCTCGGACATGACTGAATTGGTCCGTGGCTTCGACTCCGTTACTTACGAGAAGGTGATTGCGACAGCCAAGTCT
CTCCTGGGCGGCAAGGCGACGGTGTCTACCGCTGGAGACCTGTTTGTGCTGCCGTATGCCGATGAGCTGGGATTC
AAGGTCTGA
Gene >Ophio5|2985
ATGATTTCGAGATCCGCGCTCGCAAGACACGCGCAGCAGGCAGCTCGGCTCTCCTTGCCGCGTCGTGGCTTTGCC
GCCGCTGCCTCGACGGGAGCTTTCGAAACTTCGGAGATATCCGGTCTGAGAGTCGCTTCGAGGGATGTCCATGGC
CCGACGACGAAGCTGGCCGTCATTGTCAAGGCCGGCACCCGATATCAACCTTTGCCCGGCCTGACTGTTGGCCTG
GGAGAGTTCGCCTTCAAGGTGAAATACATGGACGCCATGGGCAGGCTTCGACATATGCTAACCCTGTACCGCAAC
TACAGACCACGCAGAGACGATCTGCTCTTCGTATACAGCGCGAGTCCGAGCTTCTCGGCGGTCAATTGGCTGTCT
CGCACACCCGCGAGGTCCTCCTCCTTGAGGCCAGCTTCCTCCGCGAGGATCTGCCCTTCTTCACCGAACTGCTGG
CCGAGGTCGTGTCCATGACCAAGTATACGAGTAAGGCCTTATGAGTGAGAGCTCCACGCATTGCCGAGGCTAAAG
ATGGCTCCAGCACACGAGCTTCACGAAGACGTCGAGAGGGTGCTACCTCTTAAGCAGGCCGCTTTGCAGGCAGAC
GCTTCTTCTCTTGCCCTCGACCACGCACACGCGGTCGCCTTCCATACCGGTCTCGGTGCCCCCATATACCCTTCC
TCTTTGGCGCCGTATCGCAAGTACCTAAACGAGGAGTACATTGCCAGCTATGCCGACCTCGTCTACTCGAAGCCC
AACTTTACCGTCGTGGCGGACGGTGCGTCGCCGACCAATATGTCCAAGTGGATCAGCCAGTTCTTTGCAAACGTG
CCCGCCTCTTCTCAGAGCGGCCAGACGCTCAAGGTCGAAGCGTCAAAATACCACGGCGGTGAGCAGCGGACAGAC
CACGCCGGCGGAAATTCGATGGTCATTGCCTTTCCGGGCTCCGACATGGCCGGCTCAAAACCCGAAATTCCCGTT
CTGGCGTCGCTGCTCGGCGGCAAGCCTACGATCAAATGGGCCCCTGGCTTCAGCCTGCTCTGCAAGGCCTGTGCC
GGGTTGCCCAACCTCTCCGTTTCGGCGTCGAACATGGCCTATTCCGACGCGGGTCTGATGGCCGTTCAGCTGTCC
GGTAGCGCCTCGTCCGTACGAAAGGCAGCCGAGGCCACTGCCCAGGCACTCAAGTCCATCGCGGGCGGTTCGGTC
AAGAAGGAAAACGTGAGCAGGGCCGTTGCCAACGCCAAATTTGAGGCCTTGGACCGCGCTCAACTGCGGGATAAC
GGCATACTACTGACCGGATCCGGAATTGTGACCAGAGGCAAGCCCTCGGACATGACTGAATTGGTCCGTGGCTTC
GACTCCGTTACTTACGAGAAGGTGATTGCGGTAAGATGCCTGATGAAGGACCCTGCTAGATGGTACAGACTAACA
ACTAGACAGACAGCCAAGTCTCTCCTGGGCGGCAAGGCGACGGTGTCTACCGCTGGAGACCTGTTTGTGCTGCCG
TATGCCGATGAGCTGGGATTCAAGGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail