Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2979
Gene name
Locationscaffold_238:587..2942
Strand+
Gene length (bp)2355
Transcript length (bp)1860
Coding sequence length (bp)1857
Protein length (aa) 619

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02200 STE STE like transcription factor 4.6E-56 55 163
PF00096 zf-C2H2 Zinc finger, C2H2 type 9.2E-04 511 535
PF00096 zf-C2H2 Zinc finger, C2H2 type 1.1E-05 541 563
PF13894 zf-C2H2_4 C2H2-type zinc finger 3.2E-04 541 563

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74252|STE12_EMENI Transcription factor steA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=steA PE=2 SV=1 1 596 0.0E+00
sp|P43079|CPH1_CANAL Transcription factor CPH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CPH1 PE=1 SV=3 33 204 1.0E-71
sp|Q08400|STE12_KLULA Protein STE12 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE12 PE=3 SV=2 27 203 1.0E-70
sp|P13574|STE12_YEAST Protein STE12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE12 PE=1 SV=1 21 202 2.0E-70
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 414 566 7.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74252|STE12_EMENI Transcription factor steA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=steA PE=2 SV=1 1 596 0.0E+00
sp|P43079|CPH1_CANAL Transcription factor CPH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CPH1 PE=1 SV=3 33 204 1.0E-71
sp|Q08400|STE12_KLULA Protein STE12 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE12 PE=3 SV=2 27 203 1.0E-70
sp|P13574|STE12_YEAST Protein STE12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE12 PE=1 SV=1 21 202 2.0E-70
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 414 566 7.0E-13
sp|Q02447|SP3_HUMAN Transcription factor Sp3 OS=Homo sapiens GN=SP3 PE=1 SV=3 513 585 9.0E-13
sp|O94131|CREA_GIBFU DNA-binding protein creA OS=Gibberella fujikuroi GN=CREA PE=3 SV=1 446 564 1.0E-12
sp|Q90WR8|SP3_CHICK Transcription factor Sp3 OS=Gallus gallus GN=SP3 PE=1 SV=1 513 591 1.0E-12
sp|P50898|MIG1_KLULA Regulatory protein MIG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MIG1 PE=3 SV=1 504 599 1.0E-12
sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens GN=SP1 PE=1 SV=3 505 566 2.0E-12
sp|O59958|CRE1_NEUCR DNA-binding protein cre-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cre-1 PE=2 SV=2 488 564 3.0E-12
sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 505 566 3.0E-12
sp|P39959|YEW0_YEAST Zinc finger protein YER130C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YER130C PE=3 SV=2 490 564 4.0E-12
sp|P33748|MSN2_YEAST Zinc finger protein MSN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSN2 PE=1 SV=1 496 565 4.0E-12
sp|Q02447|SP3_HUMAN Transcription factor Sp3 OS=Homo sapiens GN=SP3 PE=1 SV=3 509 566 6.0E-12
sp|O70494|SP3_MOUSE Transcription factor Sp3 OS=Mus musculus GN=Sp3 PE=1 SV=2 513 586 6.0E-12
sp|O70494|SP3_MOUSE Transcription factor Sp3 OS=Mus musculus GN=Sp3 PE=1 SV=2 509 566 7.0E-12
sp|A2QCJ9|CREA_ASPNC Probable DNA-binding protein creA OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=creA PE=3 SV=1 491 571 7.0E-12
sp|Q8VI67|SP7_MOUSE Transcription factor Sp7 OS=Mus musculus GN=Sp7 PE=1 SV=1 511 566 8.0E-12
sp|P33749|MSN4_YEAST Zinc finger protein MSN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSN4 PE=1 SV=1 493 565 8.0E-12
sp|Q24266|BTD_DROME Transcription factor btd OS=Drosophila melanogaster GN=btd PE=2 SV=1 509 564 8.0E-12
sp|Q59RR3|MNL1_CANAL Transcriptional regulator MNL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNL1 PE=3 SV=1 518 567 8.0E-12
sp|Q05620|CREA_ASPNG DNA-binding protein creA OS=Aspergillus niger GN=creA PE=3 SV=1 491 564 8.0E-12
sp|Q62445|SP4_MOUSE Transcription factor Sp4 OS=Mus musculus GN=Sp4 PE=2 SV=2 518 580 9.0E-12
sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens GN=SP4 PE=1 SV=2 518 580 9.0E-12
sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens GN=SP4 PE=1 SV=2 505 566 9.0E-12
sp|Q90WR8|SP3_CHICK Transcription factor Sp3 OS=Gallus gallus GN=SP3 PE=1 SV=1 509 566 1.0E-11
sp|Q24266|BTD_DROME Transcription factor btd OS=Drosophila melanogaster GN=btd PE=2 SV=1 517 566 1.0E-11
sp|Q62445|SP4_MOUSE Transcription factor Sp4 OS=Mus musculus GN=Sp4 PE=2 SV=2 505 566 1.0E-11
sp|P58334|KLF16_MOUSE Krueppel-like factor 16 OS=Mus musculus GN=Klf16 PE=1 SV=2 509 566 1.0E-11
sp|P53035|MIG2_YEAST Regulatory protein MIG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG2 PE=1 SV=1 517 587 1.0E-11
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 493 566 1.0E-11
sp|Q01981|CREA_EMENI DNA-binding protein creA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=creA PE=1 SV=1 505 563 1.0E-11
sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens GN=SP1 PE=1 SV=3 513 569 2.0E-11
sp|O94166|CREA_ASPAC DNA-binding protein creA OS=Aspergillus aculeatus GN=creA PE=3 SV=1 491 571 2.0E-11
sp|O14335|SCR1_SCHPO DNA-binding protein scr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scr1 PE=3 SV=1 504 564 2.0E-11
sp|Q9BXK1|KLF16_HUMAN Krueppel-like factor 16 OS=Homo sapiens GN=KLF16 PE=1 SV=1 509 566 2.0E-11
sp|Q8SUR9|Z856_ENCCU Zinc finger C2H2 protein ECU08_0560 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0560 PE=3 SV=2 513 564 2.0E-11
sp|Q0VA40|SP9_XENTR Transcription factor Sp9 OS=Xenopus tropicalis GN=sp9 PE=2 SV=1 511 566 2.0E-11
sp|P27705|MIG1_YEAST Regulatory protein MIG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG1 PE=1 SV=1 511 564 2.0E-11
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 493 566 2.0E-11
sp|Q6P0J3|SP8_DANRE Transcription factor Sp8 OS=Danio rerio GN=sp8b PE=2 SV=1 511 566 2.0E-11
sp|P0CG40|SP9_HUMAN Transcription factor Sp9 OS=Homo sapiens GN=SP9 PE=3 SV=1 511 566 2.0E-11
sp|P10069|BRLA_EMENI Regulatory protein brlA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=brlA PE=3 SV=1 513 568 2.0E-11
sp|Q64HY3|SP9_MOUSE Transcription factor Sp9 OS=Mus musculus GN=Sp9 PE=1 SV=1 511 566 2.0E-11
sp|Q9P889|CREA_ASPOR DNA-binding protein creA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=creA PE=3 SV=1 491 617 2.0E-11
sp|B8NGC8|CREA_ASPFN Probable DNA-binding protein creA OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=creA PE=3 SV=1 491 617 2.0E-11
sp|Q64HY5|SP8_CHICK Transcription factor Sp8 OS=Gallus gallus GN=SP8 PE=2 SV=1 511 566 3.0E-11
sp|Q9GL32|EGR4_BOVIN Early growth response protein 4 OS=Bos taurus GN=EGR4 PE=2 SV=1 493 566 3.0E-11
sp|Q8IXZ3|SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens GN=SP8 PE=2 SV=3 511 566 3.0E-11
sp|Q6NW96|SP9_DANRE Transcription factor Sp9 OS=Danio rerio GN=sp9 PE=2 SV=1 511 566 3.0E-11
sp|Q8BMJ8|SP8_MOUSE Transcription factor Sp8 OS=Mus musculus GN=Sp8 PE=2 SV=1 511 566 3.0E-11
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 513 569 4.0E-11
sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 513 569 4.0E-11
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 507 566 4.0E-11
sp|B0XSK6|CREA_ASPFC Probable DNA-binding protein creA OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=creA PE=3 SV=1 505 563 4.0E-11
sp|Q4X0Z3|CREA_ASPFU Probable DNA-binding protein creA OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=creA PE=3 SV=1 505 563 4.0E-11
sp|A1C6L9|CREA_ASPCL Probable DNA-binding protein creA OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=creA PE=3 SV=1 505 564 4.0E-11
sp|A1DH89|CREA_NEOFI Probable DNA-binding protein creA OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=creA PE=3 SV=1 505 564 5.0E-11
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 450 566 5.0E-11
sp|Q5XGT8|SP8_XENLA Transcription factor Sp8 OS=Xenopus laevis GN=sp8 PE=2 SV=1 511 566 5.0E-11
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 507 566 5.0E-11
sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens GN=EGR4 PE=2 SV=3 493 566 6.0E-11
sp|Q59U10|BCR1_CANAL Biofilm and cell wall regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BCR1 PE=1 SV=1 516 562 6.0E-11
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 502 566 6.0E-11
sp|Q6FJQ9|ACE2_CANGA Cell wall transcription factor ACE2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACE2 PE=3 SV=1 507 565 6.0E-11
sp|P52288|MIG1_KLUMA Regulatory protein MIG1 OS=Kluyveromyces marxianus GN=MIG1 PE=3 SV=1 513 563 7.0E-11
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 507 566 7.0E-11
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 509 566 7.0E-11
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 507 566 7.0E-11
sp|Q9P7D9|RSV1_SCHPO Zinc finger protein rsv1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsv1 PE=2 SV=1 509 566 8.0E-11
sp|Q9D2H6|SP2_MOUSE Transcription factor Sp2 OS=Mus musculus GN=Sp2 PE=2 SV=2 454 564 8.0E-11
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 507 566 8.0E-11
sp|Q5AMH6|CAS5_CANAL Cell wall integrity transcriptional regulator CAS5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAS5 PE=3 SV=1 507 581 8.0E-11
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 514 566 8.0E-11
sp|Q5E9U0|SP2_BOVIN Transcription factor Sp2 OS=Bos taurus GN=SP2 PE=2 SV=1 509 564 9.0E-11
sp|Q9HFS2|CREA_COCCA DNA-binding protein creA OS=Cochliobolus carbonum GN=CREA PE=2 SV=1 505 563 9.0E-11
sp|P18738|ZG9_XENLA Gastrula zinc finger protein XlCGF9.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 516 566 9.0E-11
sp|Q02086|SP2_HUMAN Transcription factor Sp2 OS=Homo sapiens GN=SP2 PE=1 SV=3 454 564 1.0E-10
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 500 566 1.0E-10
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 507 566 1.0E-10
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 500 566 1.0E-10
sp|Q6GQH4|EGR1A_XENLA Early growth response protein 1-A OS=Xenopus laevis GN=egr1-a PE=2 SV=1 507 566 1.0E-10
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 500 566 1.0E-10
sp|Q91660|GLI3_XENLA Zinc finger protein GLI3 OS=Xenopus laevis GN=gli3 PE=2 SV=1 509 566 1.0E-10
sp|Q10076|HSR1_SCHPO Hydrogen peroxide stress regulator 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsr1 PE=2 SV=1 509 563 2.0E-10
sp|O94130|CREA_BOTFU DNA-binding protein creA OS=Botryotinia fuckeliana GN=creA PE=3 SV=1 505 564 2.0E-10
sp|Q8TD94|KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens GN=KLF14 PE=2 SV=1 509 566 2.0E-10
sp|Q9IA31|GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus GN=GLI3 PE=1 SV=1 509 566 2.0E-10
sp|Q91690|GLI1_XENLA Zinc finger protein GLI1 (Fragment) OS=Xenopus laevis GN=gli1 PE=2 SV=2 509 566 2.0E-10
sp|Q13886|KLF9_HUMAN Krueppel-like factor 9 OS=Homo sapiens GN=KLF9 PE=1 SV=1 509 566 2.0E-10
sp|Q01713|KLF9_RAT Krueppel-like factor 9 OS=Rattus norvegicus GN=Klf9 PE=2 SV=1 509 566 2.0E-10
sp|P79288|KLF9_PIG Krueppel-like factor 9 OS=Sus scrofa GN=KLF9 PE=2 SV=3 509 566 2.0E-10
sp|Q19A40|KLF14_PANTR Krueppel-like factor 14 OS=Pan troglodytes GN=KLF14 PE=3 SV=1 509 566 2.0E-10
sp|Q14V87|KLF14_GORGO Krueppel-like factor 14 OS=Gorilla gorilla gorilla GN=KLF14 PE=3 SV=1 509 566 2.0E-10
sp|P10070|GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens GN=GLI2 PE=1 SV=4 509 566 2.0E-10
sp|Q61602|GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus GN=Gli3 PE=1 SV=2 509 566 2.0E-10
sp|Q0VGT2|GLI2_MOUSE Zinc finger protein GLI2 OS=Mus musculus GN=Gli2 PE=1 SV=2 509 566 2.0E-10
sp|O89091|KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus GN=Klf10 PE=1 SV=1 509 566 2.0E-10
sp|O35739|KLF9_MOUSE Krueppel-like factor 9 OS=Mus musculus GN=Klf9 PE=2 SV=1 509 566 3.0E-10
sp|O08876|KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus GN=Klf10 PE=2 SV=1 509 566 3.0E-10
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 518 566 3.0E-10
sp|P10071|GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens GN=GLI3 PE=1 SV=6 509 566 3.0E-10
sp|Q5IS56|GLI3_PANTR Transcriptional activator GLI3 OS=Pan troglodytes GN=GLI3 PE=2 SV=1 509 566 3.0E-10
sp|Q8TDD2|SP7_HUMAN Transcription factor Sp7 OS=Homo sapiens GN=SP7 PE=1 SV=1 518 563 3.0E-10
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 449 566 3.0E-10
sp|Q8VI67|SP7_MOUSE Transcription factor Sp7 OS=Mus musculus GN=Sp7 PE=1 SV=1 518 563 4.0E-10
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 518 583 4.0E-10
sp|A6QPT6|ZN274_BOVIN Neurotrophin receptor-interacting factor homolog OS=Bos taurus GN=ZNF274 PE=2 SV=1 514 565 4.0E-10
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 457 566 4.0E-10
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 501 607 4.0E-10
sp|P55879|GLI2_CHICK Zinc finger protein GLI2 (Fragment) OS=Gallus gallus GN=GLI2 PE=2 SV=1 509 566 4.0E-10
sp|Q91661|GLI4_XENLA Zinc finger protein GLI4 OS=Xenopus laevis GN=gli4 PE=2 SV=1 509 566 4.0E-10
sp|O95125|ZN202_HUMAN Zinc finger protein 202 OS=Homo sapiens GN=ZNF202 PE=1 SV=4 513 564 5.0E-10
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 505 566 5.0E-10
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 505 566 5.0E-10
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 505 566 5.0E-10
sp|O95863|SNAI1_HUMAN Zinc finger protein SNAI1 OS=Homo sapiens GN=SNAI1 PE=1 SV=2 509 564 5.0E-10
sp|Q9EPW2|KLF15_MOUSE Krueppel-like factor 15 OS=Mus musculus GN=Klf15 PE=1 SV=1 509 564 6.0E-10
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 515 568 6.0E-10
sp|Q9UIH9|KLF15_HUMAN Krueppel-like factor 15 OS=Homo sapiens GN=KLF15 PE=1 SV=1 509 564 6.0E-10
sp|Q6XP49|GLIS3_MOUSE Zinc finger protein GLIS3 OS=Mus musculus GN=Glis3 PE=1 SV=2 509 563 7.0E-10
sp|P19538|CI_DROME Transcriptional activator cubitus interruptus OS=Drosophila melanogaster GN=ci PE=1 SV=2 509 566 7.0E-10
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 518 567 7.0E-10
sp|P55878|GLI1_CHICK Zinc finger protein GLI1 (Fragment) OS=Gallus gallus GN=GLI1 PE=2 SV=1 509 566 7.0E-10
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 518 583 8.0E-10
sp|P08151|GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens GN=GLI1 PE=1 SV=1 509 566 8.0E-10
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 439 566 8.0E-10
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 500 566 9.0E-10
sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens GN=ZNF558 PE=2 SV=1 476 577 9.0E-10
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 514 566 1.0E-09
sp|Q96JP5|ZFP91_HUMAN E3 ubiquitin-protein ligase ZFP91 OS=Homo sapiens GN=ZFP91 PE=1 SV=1 509 566 1.0E-09
sp|P49910|ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens GN=ZNF165 PE=1 SV=1 518 567 1.0E-09
sp|Q921B4|NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus GN=Nrif2 PE=1 SV=1 518 566 1.0E-09
sp|Q13118|KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens GN=KLF10 PE=1 SV=1 509 573 1.0E-09
sp|Q8NEA6|GLIS3_HUMAN Zinc finger protein GLIS3 OS=Homo sapiens GN=GLIS3 PE=2 SV=5 509 563 1.0E-09
sp|O73694|EGR1_SERCA Early growth response protein 1 (Fragment) OS=Serinus canaria GN=EGR1 PE=3 SV=1 518 566 1.0E-09
sp|Q62511|ZFP91_MOUSE E3 ubiquitin-protein ligase ZFP91 OS=Mus musculus GN=Zfp91 PE=1 SV=3 509 566 1.0E-09
sp|Q0VA40|SP9_XENTR Transcription factor Sp9 OS=Xenopus tropicalis GN=sp9 PE=2 SV=1 513 563 2.0E-09
sp|Q64HY5|SP8_CHICK Transcription factor Sp8 OS=Gallus gallus GN=SP8 PE=2 SV=1 513 564 2.0E-09
sp|Q9Y7G2|MIG1_CANAX Regulatory protein MIG1 OS=Candida albicans GN=MIG1 PE=3 SV=1 518 564 2.0E-09
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 518 566 2.0E-09
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 518 566 2.0E-09
sp|Q6ZN55|ZN574_HUMAN Zinc finger protein 574 OS=Homo sapiens GN=ZNF574 PE=1 SV=2 509 566 2.0E-09
sp|Q9BZE0|GLIS2_HUMAN Zinc finger protein GLIS2 OS=Homo sapiens GN=GLIS2 PE=1 SV=2 454 563 2.0E-09
sp|Q12132|USV1_YEAST Nutrient and stress factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=USV1 PE=1 SV=1 518 562 2.0E-09
sp|Q5R4P8|ZN574_PONAB Zinc finger protein 574 OS=Pongo abelii GN=ZNF574 PE=2 SV=1 509 566 2.0E-09
sp|Q8NBF1|GLIS1_HUMAN Zinc finger protein GLIS1 OS=Homo sapiens GN=GLIS1 PE=2 SV=2 490 563 2.0E-09
sp|Q504L7|ZN574_RAT Zinc finger protein 574 OS=Rattus norvegicus GN=Znf574 PE=2 SV=1 509 566 2.0E-09
sp|Q8K1M4|GLIS1_MOUSE Zinc finger protein GLIS1 OS=Mus musculus GN=Glis1 PE=2 SV=2 509 563 2.0E-09
sp|Q8BY46|ZN574_MOUSE Zinc finger protein 574 OS=Mus musculus GN=Znf574 PE=1 SV=1 509 566 2.0E-09
sp|Q4R8S8|ZN574_MACFA Zinc finger protein 574 OS=Macaca fascicularis GN=ZNF574 PE=2 SV=2 509 566 2.0E-09
sp|Q6P0J3|SP8_DANRE Transcription factor Sp8 OS=Danio rerio GN=sp8b PE=2 SV=1 513 563 3.0E-09
sp|P0CG40|SP9_HUMAN Transcription factor Sp9 OS=Homo sapiens GN=SP9 PE=3 SV=1 513 563 3.0E-09
sp|Q64HY3|SP9_MOUSE Transcription factor Sp9 OS=Mus musculus GN=Sp9 PE=1 SV=1 513 563 3.0E-09
sp|Q6NW96|SP9_DANRE Transcription factor Sp9 OS=Danio rerio GN=sp9 PE=2 SV=1 513 564 3.0E-09
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 515 566 3.0E-09
sp|Q29RK0|ZN574_BOVIN Zinc finger protein 574 OS=Bos taurus GN=ZNF574 PE=2 SV=1 509 566 3.0E-09
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 515 566 3.0E-09
sp|A0JNJ4|ZN692_BOVIN Zinc finger protein 692 OS=Bos taurus GN=ZNF692 PE=2 SV=1 509 566 3.0E-09
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 515 566 3.0E-09
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 368 566 3.0E-09
sp|Q9ULD5|ZN777_HUMAN Zinc finger protein 777 OS=Homo sapiens GN=ZNF777 PE=1 SV=2 518 566 3.0E-09
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 509 564 4.0E-09
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 515 566 4.0E-09
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 518 564 4.0E-09
sp|Q13351|KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens GN=KLF1 PE=1 SV=1 510 564 4.0E-09
sp|P39943|MIG3_YEAST Transcription corepressor MIG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG3 PE=1 SV=1 513 565 4.0E-09
sp|A1XSY8|EGR2_PIG E3 SUMO-protein ligase EGR2 OS=Sus scrofa GN=EGR2 PE=2 SV=1 497 566 4.0E-09
sp|Q4R8H9|ZN274_MACFA Neurotrophin receptor-interacting factor homolog OS=Macaca fascicularis GN=ZNF274 PE=2 SV=1 476 565 4.0E-09
sp|Q05159|EGR2B_DANRE Early growth response protein 2b OS=Danio rerio GN=egr2b PE=2 SV=1 433 566 4.0E-09
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 476 565 4.0E-09
sp|Q8IXZ3|SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens GN=SP8 PE=2 SV=3 513 563 5.0E-09
sp|Q8BMJ8|SP8_MOUSE Transcription factor Sp8 OS=Mus musculus GN=Sp8 PE=2 SV=1 513 563 5.0E-09
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 515 566 5.0E-09
sp|Q9US36|KLF1_SCHPO Zinc finger protein klf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klf1 PE=2 SV=1 511 571 5.0E-09
sp|P26633|EGR2_CRIGR E3 SUMO-protein ligase EGR2 (Fragment) OS=Cricetulus griseus GN=EGR2 PE=2 SV=1 518 566 5.0E-09
sp|P08153|SWI5_YEAST Transcriptional factor SWI5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI5 PE=1 SV=1 507 563 5.0E-09
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 509 564 5.0E-09
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 478 564 5.0E-09
sp|Q08427|EGR2_XENLA Early growth response protein 2 OS=Xenopus laevis GN=egr2 PE=2 SV=1 497 566 5.0E-09
sp|P21192|ACE2_YEAST Metallothionein expression activator OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACE2 PE=1 SV=1 468 564 5.0E-09
sp|P78871|RST2_SCHPO Zinc finger protein rst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rst2 PE=2 SV=2 484 565 5.0E-09
sp|P11161|EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens GN=EGR2 PE=1 SV=3 508 572 5.0E-09
sp|Q00453|RGM1_YEAST Probable transcription repressor protein RGM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGM1 PE=1 SV=2 516 601 5.0E-09
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 518 566 5.0E-09
sp|P08152|EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus GN=Egr2 PE=1 SV=3 497 566 5.0E-09
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 495 564 6.0E-09
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 518 567 6.0E-09
sp|P11161|EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens GN=EGR2 PE=1 SV=3 497 566 6.0E-09
sp|Q99612|KLF6_HUMAN Krueppel-like factor 6 OS=Homo sapiens GN=KLF6 PE=1 SV=3 468 563 6.0E-09
sp|P51774|EGR2_RAT E3 SUMO-protein ligase EGR2 OS=Rattus norvegicus GN=Egr2 PE=2 SV=2 497 566 6.0E-09
sp|P47806|GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus GN=Gli1 PE=1 SV=4 509 566 6.0E-09
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 508 566 6.0E-09
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 518 570 6.0E-09
sp|Q01779|KRUP_MUSDO Protein krueppel (Fragment) OS=Musca domestica GN=Kr PE=3 SV=1 516 566 6.0E-09
sp|Q9ERR8|ZN319_MOUSE Zinc finger protein 319 OS=Mus musculus GN=Znf319 PE=2 SV=1 507 566 6.0E-09
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 518 567 7.0E-09
sp|A1XSY8|EGR2_PIG E3 SUMO-protein ligase EGR2 OS=Sus scrofa GN=EGR2 PE=2 SV=1 508 566 7.0E-09
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 507 566 7.0E-09
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 517 564 7.0E-09
sp|P41696|AZF1_YEAST Asparagine-rich zinc finger protein AZF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZF1 PE=1 SV=1 509 566 7.0E-09
sp|Q98T94|GLIS2_XENLA Zinc finger protein GLIS2 OS=Xenopus laevis GN=glis2 PE=2 SV=1 454 563 7.0E-09
sp|Q5JT82|KLF17_HUMAN Krueppel-like factor 17 OS=Homo sapiens GN=KLF17 PE=1 SV=1 509 563 7.0E-09
sp|P26635|EGR2_POERE Early growth response protein 2 (Fragment) OS=Poecilia reticulata GN=egr2 PE=3 SV=1 518 566 7.0E-09
sp|Q5XGT8|SP8_XENLA Transcription factor Sp8 OS=Xenopus laevis GN=sp8 PE=2 SV=1 513 563 8.0E-09
sp|P08152|EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus GN=Egr2 PE=1 SV=3 508 566 8.0E-09
sp|P51774|EGR2_RAT E3 SUMO-protein ligase EGR2 OS=Rattus norvegicus GN=Egr2 PE=2 SV=2 508 566 8.0E-09
sp|Q01792|KRUP_BRACO Protein krueppel (Fragment) OS=Bradysia coprophila GN=Kr PE=3 SV=1 516 566 8.0E-09
sp|Q02035|KRUP_PSYCI Protein krueppel (Fragment) OS=Psychoda cinerea GN=Kr PE=3 SV=1 516 566 8.0E-09
sp|Q6ZN79|Z705A_HUMAN Zinc finger protein 705A OS=Homo sapiens GN=ZNF705A PE=2 SV=1 494 563 8.0E-09
sp|Q15973|ZN124_HUMAN Zinc finger protein 124 OS=Homo sapiens GN=ZNF124 PE=1 SV=2 392 566 8.0E-09
sp|P31507|KRUP_APIME Protein krueppel (Fragment) OS=Apis mellifera GN=Kr PE=3 SV=1 516 566 9.0E-09
sp|O43830|ZNF73_HUMAN Zinc finger protein 73 OS=Homo sapiens GN=ZNF73 PE=3 SV=1 478 567 9.0E-09
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 515 566 9.0E-09
sp|Q3KNW1|SNAI3_HUMAN Zinc finger protein SNAI3 OS=Homo sapiens GN=SNAI3 PE=2 SV=1 513 581 9.0E-09
sp|Q9EPW2|KLF15_MOUSE Krueppel-like factor 15 OS=Mus musculus GN=Klf15 PE=1 SV=1 509 563 1.0E-08
sp|Q9UIH9|KLF15_HUMAN Krueppel-like factor 15 OS=Homo sapiens GN=KLF15 PE=1 SV=1 509 563 1.0E-08
sp|P34708|TRA1_CAEEL Sex-determining transformer protein 1 OS=Caenorhabditis elegans GN=tra-1 PE=1 SV=1 509 564 1.0E-08
sp|Q8VDL9|GLIS2_MOUSE Zinc finger protein GLIS2 OS=Mus musculus GN=Glis2 PE=1 SV=1 509 563 1.0E-08
sp|P39768|OPA_DROME Pair-rule protein odd-paired OS=Drosophila melanogaster GN=opa PE=2 SV=2 499 566 1.0E-08
sp|O08584|KLF6_MOUSE Krueppel-like factor 6 OS=Mus musculus GN=Klf6 PE=2 SV=3 474 563 1.0E-08
sp|Q3SY56|SP6_HUMAN Transcription factor Sp6 OS=Homo sapiens GN=SP6 PE=2 SV=1 469 564 1.0E-08
sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens GN=KLF11 PE=1 SV=2 509 566 1.0E-08
sp|O35819|KLF6_RAT Krueppel-like factor 6 OS=Rattus norvegicus GN=Klf6 PE=2 SV=2 474 563 1.0E-08
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 513 567 1.0E-08
sp|Q4V8E9|NRIF1_RAT Neurotrophin receptor-interacting factor 1 OS=Rattus norvegicus GN=Nrif1 PE=2 SV=1 518 563 1.0E-08
sp|Q17308|TRA1_CAEBR Sex-determining transformer protein 1 OS=Caenorhabditis briggsae GN=tra-1 PE=1 SV=1 509 564 1.0E-08
sp|Q04545|TDA9_YEAST Probable transcription factor TDA9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA9 PE=1 SV=1 496 595 1.0E-08
sp|Q3U381|ZN692_MOUSE Zinc finger protein 692 OS=Mus musculus GN=Znf692 PE=2 SV=1 509 566 1.0E-08
sp|Q8BI66|ZN526_MOUSE Zinc finger protein 526 OS=Mus musculus GN=Znf526 PE=2 SV=1 468 564 1.0E-08
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 401 564 1.0E-08
sp|Q5EAC5|ZN410_BOVIN Zinc finger protein 410 OS=Bos taurus GN=ZNF410 PE=2 SV=1 509 566 1.0E-08
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 518 563 1.0E-08
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 518 566 1.0E-08
sp|Q68H95|REPI1_RAT Replication initiator 1 OS=Rattus norvegicus GN=Repin1 PE=2 SV=1 515 605 1.0E-08
sp|Q5U4E2|REPI1_MOUSE Replication initiator 1 OS=Mus musculus GN=Repin1 PE=1 SV=1 515 605 1.0E-08
sp|P58334|KLF16_MOUSE Krueppel-like factor 16 OS=Mus musculus GN=Klf16 PE=1 SV=2 512 563 2.0E-08
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 518 585 2.0E-08
sp|Q13886|KLF9_HUMAN Krueppel-like factor 9 OS=Homo sapiens GN=KLF9 PE=1 SV=1 505 564 2.0E-08
sp|Q01713|KLF9_RAT Krueppel-like factor 9 OS=Rattus norvegicus GN=Klf9 PE=2 SV=1 505 564 2.0E-08
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 508 571 2.0E-08
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 508 571 2.0E-08
sp|Q05159|EGR2B_DANRE Early growth response protein 2b OS=Danio rerio GN=egr2b PE=2 SV=1 508 566 2.0E-08
sp|Q08427|EGR2_XENLA Early growth response protein 2 OS=Xenopus laevis GN=egr2 PE=2 SV=1 508 566 2.0E-08
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 518 566 2.0E-08
sp|Q9P2F9|ZN319_HUMAN Zinc finger protein 319 OS=Homo sapiens GN=ZNF319 PE=1 SV=2 509 566 2.0E-08
sp|Q9Y2Q1|ZN257_HUMAN Zinc finger protein 257 OS=Homo sapiens GN=ZNF257 PE=2 SV=2 518 566 2.0E-08
sp|Q9Y2Q1|ZN257_HUMAN Zinc finger protein 257 OS=Homo sapiens GN=ZNF257 PE=2 SV=2 518 568 2.0E-08
sp|Q02085|SNAI1_MOUSE Zinc finger protein SNAI1 OS=Mus musculus GN=Snai1 PE=1 SV=1 509 564 2.0E-08
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 499 566 2.0E-08
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 509 579 2.0E-08
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 518 566 2.0E-08
sp|Q9BU19|ZN692_HUMAN Zinc finger protein 692 OS=Homo sapiens GN=ZNF692 PE=1 SV=1 509 566 2.0E-08
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 509 566 2.0E-08
sp|P18734|ZG67_XENLA Gastrula zinc finger protein XlCGF67.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 482 566 2.0E-08
sp|A6QR00|ZN526_BOVIN Zinc finger protein 526 OS=Bos taurus GN=ZNF526 PE=2 SV=1 468 564 2.0E-08
sp|P46099|KLF1_MOUSE Krueppel-like factor 1 OS=Mus musculus GN=Klf1 PE=1 SV=2 503 564 2.0E-08
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 518 566 2.0E-08
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 517 566 2.0E-08
sp|P30373|CKR1_CHICK Zinc finger protein CKR1 OS=Gallus gallus PE=2 SV=1 515 563 2.0E-08
sp|Q25515|KRUP_MANSE Protein krueppel (Fragment) OS=Manduca sexta GN=Kr PE=2 SV=1 518 566 2.0E-08
sp|P46974|RSF2_YEAST Respiration factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSF2 PE=1 SV=1 516 561 2.0E-08
sp|Q9ESX2|SP6_MOUSE Transcription factor Sp6 OS=Mus musculus GN=Sp6 PE=2 SV=2 470 564 2.0E-08
sp|Q8TF50|ZN526_HUMAN Zinc finger protein 526 OS=Homo sapiens GN=ZNF526 PE=2 SV=2 478 564 2.0E-08
sp|O43623|SNAI2_HUMAN Zinc finger protein SNAI2 OS=Homo sapiens GN=SNAI2 PE=1 SV=1 513 564 2.0E-08
sp|Q9BWE0|REPI1_HUMAN Replication initiator 1 OS=Homo sapiens GN=REPIN1 PE=1 SV=1 515 603 2.0E-08
sp|P07248|ADR1_YEAST Regulatory protein ADR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADR1 PE=1 SV=2 509 564 2.0E-08
sp|Q91924|SNAI2_XENLA Zinc finger protein SNAI2 OS=Xenopus laevis GN=snai2 PE=1 SV=1 513 564 2.0E-08
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 509 566 2.0E-08
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 509 566 2.0E-08
sp|P0CI00|Z705B_HUMAN Putative zinc finger protein 705B OS=Homo sapiens GN=ZNF705B PE=5 SV=1 496 563 2.0E-08
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 518 595 2.0E-08
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 508 594 3.0E-08
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 508 594 3.0E-08
sp|P79288|KLF9_PIG Krueppel-like factor 9 OS=Sus scrofa GN=KLF9 PE=2 SV=3 513 564 3.0E-08
sp|O35739|KLF9_MOUSE Krueppel-like factor 9 OS=Mus musculus GN=Klf9 PE=2 SV=1 505 564 3.0E-08
sp|O95125|ZN202_HUMAN Zinc finger protein 202 OS=Homo sapiens GN=ZNF202 PE=1 SV=4 484 563 3.0E-08
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 508 566 3.0E-08
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 517 565 3.0E-08
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 517 565 3.0E-08
sp|P18719|ZG32_XENLA Gastrula zinc finger protein XlCGF32.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 509 567 3.0E-08
sp|O08954|SNAI2_RAT Zinc finger protein SNAI2 OS=Rattus norvegicus GN=Snai2 PE=2 SV=2 513 564 3.0E-08
sp|P0CH99|Z705D_HUMAN Zinc finger protein 705D OS=Homo sapiens GN=ZNF705D PE=2 SV=1 496 563 3.0E-08
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 518 566 3.0E-08
sp|Q8N9Z0|ZN610_HUMAN Zinc finger protein 610 OS=Homo sapiens GN=ZNF610 PE=2 SV=2 462 566 3.0E-08
sp|P97469|SNAI2_MOUSE Zinc finger protein SNAI2 OS=Mus musculus GN=Snai2 PE=1 SV=1 513 564 3.0E-08
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 518 566 3.0E-08
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 518 572 3.0E-08
sp|O77027|CI_DROYA Protein cubitus interruptus (Fragment) OS=Drosophila yakuba GN=ci PE=3 SV=1 518 566 3.0E-08
sp|Q5AF56|ADR1_CANAL Transcriptional regulator ADR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADR1 PE=2 SV=1 517 559 3.0E-08
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 518 566 3.0E-08
sp|P26634|EGR2_CERTH E3 SUMO-protein ligase EGR2 (Fragment) OS=Cerdocyon thous GN=EGR2 PE=3 SV=1 518 566 3.0E-08
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 509 566 3.0E-08
sp|O73693|EGR1_TAEGU Early growth response protein 1 (Fragment) OS=Taeniopygia guttata GN=EGR1 PE=3 SV=1 518 566 3.0E-08
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 518 572 3.0E-08
sp|A8MVS1|Z705F_HUMAN Zinc finger protein 705F OS=Homo sapiens GN=ZNF705F PE=3 SV=1 496 563 3.0E-08
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 494 566 3.0E-08
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 518 572 3.0E-08
sp|Q7TQ40|ZIC5_MOUSE Zinc finger protein ZIC 5 OS=Mus musculus GN=Zic5 PE=1 SV=1 468 566 3.0E-08
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 509 564 3.0E-08
sp|Q19A41|KLF14_MOUSE Krueppel-like factor 14 OS=Mus musculus GN=Klf14 PE=2 SV=1 509 566 3.0E-08
sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens GN=EGR4 PE=2 SV=3 508 600 4.0E-08
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 515 566 4.0E-08
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 518 572 4.0E-08
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 499 566 4.0E-08
sp|Q10938|YWS2_CAEEL Putative zinc finger protein B0310.2 OS=Caenorhabditis elegans GN=B0310.2 PE=3 SV=1 518 564 4.0E-08
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 515 567 4.0E-08
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 509 564 4.0E-08
sp|Q9NZV7|ZIM2_HUMAN Zinc finger imprinted 2 OS=Homo sapiens GN=ZIM2 PE=2 SV=1 512 570 4.0E-08
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 518 566 4.0E-08
sp|Q9NQX1|PRDM5_HUMAN PR domain zinc finger protein 5 OS=Homo sapiens GN=PRDM5 PE=1 SV=2 515 566 4.0E-08
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 518 566 4.0E-08
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 518 566 4.0E-08
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 518 566 4.0E-08
sp|Q95K49|ZN614_MACFA Zinc finger protein 614 OS=Macaca fascicularis GN=ZNF614 PE=2 SV=1 518 583 4.0E-08
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 518 566 4.0E-08
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 509 564 4.0E-08
sp|Q0VCC5|REPI1_BOVIN Replication initiator 1 OS=Bos taurus GN=REPIN1 PE=2 SV=1 515 598 4.0E-08
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 514 566 4.0E-08
sp|Q293Q2|SQZ_DROPS Zinc finger protein squeeze OS=Drosophila pseudoobscura pseudoobscura GN=sqz PE=3 SV=2 499 563 4.0E-08
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 509 564 4.0E-08
sp|O73692|EGR1_COTJA Early growth response protein 1 (Fragment) OS=Coturnix coturnix japonica GN=EGR1 PE=3 SV=1 518 566 4.0E-08
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 476 564 4.0E-08
sp|Q9Y2Y9|KLF13_HUMAN Krueppel-like factor 13 OS=Homo sapiens GN=KLF13 PE=1 SV=1 512 596 4.0E-08
sp|Q9JJZ6|KLF13_MOUSE Krueppel-like factor 13 OS=Mus musculus GN=Klf13 PE=1 SV=2 512 596 4.0E-08
sp|Q9GL32|EGR4_BOVIN Early growth response protein 4 OS=Bos taurus GN=EGR4 PE=2 SV=1 508 594 5.0E-08
sp|Q6GQH4|EGR1A_XENLA Early growth response protein 1-A OS=Xenopus laevis GN=egr1-a PE=2 SV=1 464 571 5.0E-08
sp|Q8TD94|KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens GN=KLF14 PE=2 SV=1 512 563 5.0E-08
sp|O89091|KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus GN=Klf10 PE=1 SV=1 509 563 5.0E-08
sp|O08876|KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus GN=Klf10 PE=2 SV=1 509 563 5.0E-08
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 518 566 5.0E-08
sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens GN=ZNF558 PE=2 SV=1 518 565 5.0E-08
sp|Q504L7|ZN574_RAT Zinc finger protein 574 OS=Rattus norvegicus GN=Znf574 PE=2 SV=1 514 576 5.0E-08
sp|Q8BY46|ZN574_MOUSE Zinc finger protein 574 OS=Mus musculus GN=Znf574 PE=1 SV=1 514 576 5.0E-08
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 511 566 5.0E-08
sp|Q19A41|KLF14_MOUSE Krueppel-like factor 14 OS=Mus musculus GN=Klf14 PE=2 SV=1 512 563 5.0E-08
sp|Q9JKY3|ZBT18_RAT Zinc finger and BTB domain-containing protein 18 OS=Rattus norvegicus GN=Zbtb18 PE=1 SV=1 515 566 5.0E-08
sp|A0JN76|ZBT18_BOVIN Zinc finger and BTB domain-containing protein 18 OS=Bos taurus GN=ZBTB18 PE=2 SV=2 515 566 5.0E-08
sp|Q9WUK6|ZBT18_MOUSE Zinc finger and BTB domain-containing protein 18 OS=Mus musculus GN=Zbtb18 PE=1 SV=1 515 566 5.0E-08
sp|Q99592|ZBT18_HUMAN Zinc finger and BTB domain-containing protein 18 OS=Homo sapiens GN=ZBTB18 PE=1 SV=1 515 566 5.0E-08
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 518 572 5.0E-08
sp|O15090|ZN536_HUMAN Zinc finger protein 536 OS=Homo sapiens GN=ZNF536 PE=1 SV=3 515 566 5.0E-08
sp|Q5A4K7|TRY5_CANAL Transcriptional regulator of yeast form adherence 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRY5 PE=3 SV=1 509 562 5.0E-08
sp|Q9VDZ3|SQZ_DROME Zinc finger protein squeeze OS=Drosophila melanogaster GN=sqz PE=1 SV=2 499 563 5.0E-08
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 509 566 5.0E-08
sp|Q8K083|ZN536_MOUSE Zinc finger protein 536 OS=Mus musculus GN=Znf536 PE=2 SV=1 515 566 5.0E-08
sp|Q9VI93|RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster GN=rn PE=1 SV=2 499 566 5.0E-08
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 494 567 5.0E-08
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 518 566 5.0E-08
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 483 566 5.0E-08
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 518 566 5.0E-08
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 514 563 5.0E-08
sp|Q6GL52|ZN574_XENTR Zinc finger protein 574 OS=Xenopus tropicalis GN=znf574 PE=2 SV=1 509 566 5.0E-08
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 509 566 5.0E-08
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 509 564 5.0E-08
sp|Q9CXE0|PRDM5_MOUSE PR domain zinc finger protein 5 OS=Mus musculus GN=Prdm5 PE=2 SV=2 515 566 5.0E-08
sp|Q49A33|Z876P_HUMAN Putative zinc finger protein 876 OS=Homo sapiens GN=ZNF876P PE=5 SV=3 509 566 5.0E-08
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 488 576 5.0E-08
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 508 571 6.0E-08
sp|Q19A40|KLF14_PANTR Krueppel-like factor 14 OS=Pan troglodytes GN=KLF14 PE=3 SV=1 512 563 6.0E-08
sp|Q14V87|KLF14_GORGO Krueppel-like factor 14 OS=Gorilla gorilla gorilla GN=KLF14 PE=3 SV=1 512 563 6.0E-08
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 518 572 6.0E-08
sp|Q6ZN55|ZN574_HUMAN Zinc finger protein 574 OS=Homo sapiens GN=ZNF574 PE=1 SV=2 514 576 6.0E-08
sp|Q5R4P8|ZN574_PONAB Zinc finger protein 574 OS=Pongo abelii GN=ZNF574 PE=2 SV=1 514 576 6.0E-08
sp|Q4R8S8|ZN574_MACFA Zinc finger protein 574 OS=Macaca fascicularis GN=ZNF574 PE=2 SV=2 514 576 6.0E-08
sp|Q29RK0|ZN574_BOVIN Zinc finger protein 574 OS=Bos taurus GN=ZNF574 PE=2 SV=1 514 576 6.0E-08
sp|Q13351|KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens GN=KLF1 PE=1 SV=1 509 563 6.0E-08
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 473 566 6.0E-08
sp|P30373|CKR1_CHICK Zinc finger protein CKR1 OS=Gallus gallus PE=2 SV=1 518 565 6.0E-08
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 518 566 6.0E-08
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 509 564 6.0E-08
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 500 566 6.0E-08
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 491 566 6.0E-08
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 509 564 6.0E-08
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 496 568 6.0E-08
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 518 566 6.0E-08
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 518 566 6.0E-08
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 518 572 6.0E-08
sp|Q9ET58|KLF2_RAT Krueppel-like factor 2 OS=Rattus norvegicus GN=Klf2 PE=1 SV=1 510 564 6.0E-08
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 515 566 6.0E-08
sp|Q801P1|ZBT18_XENLA Zinc finger and BTB domain-containing protein 18 OS=Xenopus laevis GN=zbtb18 PE=2 SV=2 515 566 6.0E-08
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 508 566 7.0E-08
sp|Q13118|KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens GN=KLF10 PE=1 SV=1 509 563 7.0E-08
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 442 567 7.0E-08
sp|Q9NQX1|PRDM5_HUMAN PR domain zinc finger protein 5 OS=Homo sapiens GN=PRDM5 PE=1 SV=2 515 566 7.0E-08
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 518 564 7.0E-08
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 509 566 7.0E-08
sp|Q1L8W0|ZBT18_DANRE Zinc finger and BTB domain-containing protein 18 OS=Danio rerio GN=zbtb18 PE=2 SV=1 512 566 7.0E-08
sp|O73691|EGR1_CHICK Early growth response protein 1 (Fragment) OS=Gallus gallus GN=EGR1 PE=3 SV=1 518 566 7.0E-08
sp|Q9UL58|ZN215_HUMAN Zinc finger protein 215 OS=Homo sapiens GN=ZNF215 PE=2 SV=2 482 566 7.0E-08
sp|Q9Y2A4|ZN443_HUMAN Zinc finger protein 443 OS=Homo sapiens GN=ZNF443 PE=2 SV=2 518 566 7.0E-08
sp|Q01871|KRUP_EUSPL Protein krueppel (Fragment) OS=Euscelis plebejus GN=Kr PE=3 SV=1 518 566 7.0E-08
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 509 566 7.0E-08
sp|Q5A4H5|CRZ1_CANAL Transcriptional regulator CRZ1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRZ1 PE=1 SV=1 518 563 7.0E-08
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 518 566 7.0E-08
sp|Q16670|ZSC26_HUMAN Zinc finger and SCAN domain-containing protein 26 OS=Homo sapiens GN=ZSCAN26 PE=1 SV=2 476 567 7.0E-08
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 508 566 8.0E-08
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 515 566 8.0E-08
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 507 566 8.0E-08
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 518 566 8.0E-08
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 508 563 8.0E-08
sp|Q9CXE0|PRDM5_MOUSE PR domain zinc finger protein 5 OS=Mus musculus GN=Prdm5 PE=2 SV=2 515 566 8.0E-08
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 518 566 8.0E-08
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 518 566 8.0E-08
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 518 566 8.0E-08
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 509 566 8.0E-08
sp|Q60843|KLF2_MOUSE Krueppel-like factor 2 OS=Mus musculus GN=Klf2 PE=1 SV=2 510 564 8.0E-08
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 518 566 8.0E-08
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 509 566 8.0E-08
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 515 566 8.0E-08
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 518 571 9.0E-08
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 515 566 9.0E-08
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 509 566 9.0E-08
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 507 566 9.0E-08
sp|O73693|EGR1_TAEGU Early growth response protein 1 (Fragment) OS=Taeniopygia guttata GN=EGR1 PE=3 SV=1 518 566 9.0E-08
sp|Q29W20|EGR1_BOVIN Early growth response protein 1 OS=Bos taurus GN=EGR1 PE=2 SV=1 507 566 9.0E-08
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 518 566 9.0E-08
sp|Q9QY31|SNAI3_MOUSE Zinc finger protein SNAI3 OS=Mus musculus GN=Snai3 PE=2 SV=1 513 563 9.0E-08
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 518 566 9.0E-08
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 518 563 9.0E-08
sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 509 566 9.0E-08
sp|Q3U3I9|ZN865_MOUSE Zinc finger protein 865 OS=Mus musculus GN=Znf865 PE=2 SV=1 509 566 9.0E-08
sp|Q3SXZ3|ZN718_HUMAN Zinc finger protein 718 OS=Homo sapiens GN=ZNF718 PE=2 SV=1 518 564 9.0E-08
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 518 566 9.0E-08
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 518 566 9.0E-08
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 518 586 9.0E-08
sp|Q9D2H6|SP2_MOUSE Transcription factor Sp2 OS=Mus musculus GN=Sp2 PE=2 SV=2 518 568 1.0E-07
sp|Q5E9U0|SP2_BOVIN Transcription factor Sp2 OS=Bos taurus GN=SP2 PE=2 SV=1 518 563 1.0E-07
sp|P18738|ZG9_XENLA Gastrula zinc finger protein XlCGF9.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 518 566 1.0E-07
sp|Q02086|SP2_HUMAN Transcription factor Sp2 OS=Homo sapiens GN=SP2 PE=1 SV=3 518 563 1.0E-07
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 483 566 1.0E-07
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 483 566 1.0E-07
sp|A6QPT6|ZN274_BOVIN Neurotrophin receptor-interacting factor homolog OS=Bos taurus GN=ZNF274 PE=2 SV=1 518 566 1.0E-07
sp|Q921B4|NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus GN=Nrif2 PE=1 SV=1 471 572 1.0E-07
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 515 566 1.0E-07
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 515 566 1.0E-07
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 518 567 1.0E-07
sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens GN=KLF11 PE=1 SV=2 509 563 1.0E-07
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 515 564 1.0E-07
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 518 602 1.0E-07
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 508 566 1.0E-07
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 518 563 1.0E-07
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 518 566 1.0E-07
sp|O73692|EGR1_COTJA Early growth response protein 1 (Fragment) OS=Coturnix coturnix japonica GN=EGR1 PE=3 SV=1 518 570 1.0E-07
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 514 566 1.0E-07
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 518 566 1.0E-07
sp|Q6GL52|ZN574_XENTR Zinc finger protein 574 OS=Xenopus tropicalis GN=znf574 PE=2 SV=1 514 566 1.0E-07
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 518 587 1.0E-07
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 514 566 1.0E-07
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 514 566 1.0E-07
sp|Q3SXZ3|ZN718_HUMAN Zinc finger protein 718 OS=Homo sapiens GN=ZNF718 PE=2 SV=1 518 564 1.0E-07
sp|Q96MX3|ZNF48_HUMAN Zinc finger protein 48 OS=Homo sapiens GN=ZNF48 PE=1 SV=2 509 566 1.0E-07
sp|Q60980|KLF3_MOUSE Krueppel-like factor 3 OS=Mus musculus GN=Klf3 PE=1 SV=1 481 563 1.0E-07
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 518 566 1.0E-07
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 518 567 1.0E-07
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 509 567 1.0E-07
sp|B4DX44|ZN736_HUMAN Zinc finger protein 736 OS=Homo sapiens GN=ZNF736 PE=2 SV=2 518 566 1.0E-07
sp|Q5HY98|ZN766_HUMAN Zinc finger protein 766 OS=Homo sapiens GN=ZNF766 PE=2 SV=1 504 566 1.0E-07
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 518 573 1.0E-07
sp|Q01793|KRUP_TRICA Protein krueppel (Fragment) OS=Tribolium castaneum GN=Kr PE=3 SV=1 518 566 1.0E-07
sp|Q966L8|CHE1_CAEEL Transcription factor che-1 OS=Caenorhabditis elegans GN=che-1 PE=1 SV=3 517 566 1.0E-07
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 518 564 1.0E-07
sp|Q3MHQ4|SNAI2_BOVIN Zinc finger protein SNAI2 OS=Bos taurus GN=SNAI2 PE=2 SV=1 513 564 1.0E-07
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 518 577 1.0E-07
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 518 566 1.0E-07
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 518 566 1.0E-07
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 518 577 1.0E-07
sp|P56670|MAZ_MESAU Myc-associated zinc finger protein (Fragment) OS=Mesocricetus auratus GN=MAZ PE=2 SV=1 509 563 1.0E-07
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 518 564 1.0E-07
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 514 567 1.0E-07
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 518 567 1.0E-07
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 518 566 1.0E-07
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 518 566 1.0E-07
sp|P38082|NRG2_YEAST Probable transcriptional regulator NRG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NRG2 PE=1 SV=1 485 566 1.0E-07
sp|P0CJ78|ZN865_HUMAN Zinc finger protein 865 OS=Homo sapiens GN=ZNF865 PE=3 SV=1 507 566 1.0E-07
sp|Q60793|KLF4_MOUSE Krueppel-like factor 4 OS=Mus musculus GN=Klf4 PE=1 SV=3 510 564 1.0E-07
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 518 563 1.0E-07
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 518 563 1.0E-07
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 508 566 1.0E-07
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 495 566 1.0E-07
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 518 563 1.0E-07
sp|P57682|KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens GN=KLF3 PE=1 SV=1 481 563 1.0E-07
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 504 567 1.0E-07
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 445 573 1.0E-07
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 518 566 1.0E-07
sp|Q3US17|ZNF48_MOUSE Zinc finger protein 48 OS=Mus musculus GN=Znf48 PE=1 SV=2 509 566 1.0E-07
sp|Q8BKX7|ZN410_MOUSE Zinc finger protein 410 OS=Mus musculus GN=Znf410 PE=2 SV=2 509 566 1.0E-07
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 518 578 1.0E-07
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 518 563 1.0E-07
sp|Q9P2Y4|ZN219_HUMAN Zinc finger protein 219 OS=Homo sapiens GN=ZNF219 PE=1 SV=2 515 567 1.0E-07
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 518 563 1.0E-07
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 509 566 1.0E-07
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 504 567 1.0E-07
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 445 573 1.0E-07
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 518 566 1.0E-07
sp|B2RXF5|ZBT42_HUMAN Zinc finger and BTB domain-containing protein 42 OS=Homo sapiens GN=ZBTB42 PE=1 SV=2 515 566 1.0E-07
sp|P08044|SNAI_DROME Protein snail OS=Drosophila melanogaster GN=sna PE=1 SV=2 513 563 1.0E-07
sp|Q86VK4|ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens GN=ZNF410 PE=1 SV=2 509 566 1.0E-07
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 504 567 1.0E-07
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 518 618 1.0E-07
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 504 567 1.0E-07
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 509 564 1.0E-07
sp|Q15935|ZNF77_HUMAN Zinc finger protein 77 OS=Homo sapiens GN=ZNF77 PE=2 SV=2 509 567 1.0E-07
sp|P19382|SNAI1_XENLA Protein snail homolog Sna OS=Xenopus laevis GN=snai1 PE=1 SV=1 509 564 1.0E-07
sp|A6QNZ0|ZSC26_BOVIN Zinc finger and SCAN domain-containing protein 26 OS=Bos taurus GN=ZSCAN26 PE=2 SV=1 501 567 1.0E-07
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 518 566 1.0E-07
sp|Q13887|KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens GN=KLF5 PE=1 SV=2 509 564 1.0E-07
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 513 566 2.0E-07
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 518 566 2.0E-07
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 483 566 2.0E-07
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 518 566 2.0E-07
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 513 566 2.0E-07
sp|A6QPT6|ZN274_BOVIN Neurotrophin receptor-interacting factor homolog OS=Bos taurus GN=ZNF274 PE=2 SV=1 465 566 2.0E-07
sp|P39768|OPA_DROME Pair-rule protein odd-paired OS=Drosophila melanogaster GN=opa PE=2 SV=2 509 566 2.0E-07
sp|Q4V8E9|NRIF1_RAT Neurotrophin receptor-interacting factor 1 OS=Rattus norvegicus GN=Nrif1 PE=2 SV=1 518 566 2.0E-07
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 515 615 2.0E-07
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 510 572 2.0E-07
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 515 566 2.0E-07
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 515 566 2.0E-07
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 514 563 2.0E-07
sp|P30373|CKR1_CHICK Zinc finger protein CKR1 OS=Gallus gallus PE=2 SV=1 518 563 2.0E-07
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 518 571 2.0E-07
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 514 566 2.0E-07
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 518 593 2.0E-07
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 483 566 2.0E-07
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 518 566 2.0E-07
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 518 566 2.0E-07
sp|O73691|EGR1_CHICK Early growth response protein 1 (Fragment) OS=Gallus gallus GN=EGR1 PE=3 SV=1 518 566 2.0E-07
sp|Q5HY98|ZN766_HUMAN Zinc finger protein 766 OS=Homo sapiens GN=ZNF766 PE=2 SV=1 518 566 2.0E-07
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 514 563 2.0E-07
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 445 573 2.0E-07
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 445 573 2.0E-07
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 518 566 2.0E-07
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 518 563 2.0E-07
sp|Q9NX65|ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens GN=ZSCAN32 PE=1 SV=3 515 566 2.0E-07
sp|O88553|ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus GN=Zfp37 PE=2 SV=1 513 566 2.0E-07
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 507 566 2.0E-07
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 518 567 2.0E-07
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 509 569 2.0E-07
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 509 566 2.0E-07
sp|Q567C6|ZN367_DANRE Zinc finger protein 367 OS=Danio rerio GN=znf367 PE=2 SV=1 489 566 2.0E-07
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 493 566 2.0E-07
sp|Q96T25|ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens GN=ZIC5 PE=1 SV=2 499 566 2.0E-07
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 500 567 2.0E-07
sp|Q6PDB4|ZN880_HUMAN Zinc finger protein 880 OS=Homo sapiens GN=ZNF880 PE=2 SV=2 501 566 2.0E-07
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 518 566 2.0E-07
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 500 566 2.0E-07
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 509 566 2.0E-07
sp|Q6NRM8|ZB183_XENLA Zinc finger and BTB domain-containing protein 18.3 OS=Xenopus laevis GN=zbtb18.3 PE=2 SV=1 515 566 2.0E-07
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 498 566 2.0E-07
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 518 566 2.0E-07
sp|Q15929|ZNF56_HUMAN Putative zinc finger protein 56 OS=Homo sapiens GN=ZNF56 PE=5 SV=2 493 566 2.0E-07
sp|Q9Y5W3|KLF2_HUMAN Krueppel-like factor 2 OS=Homo sapiens GN=KLF2 PE=1 SV=2 510 564 2.0E-07
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 518 566 2.0E-07
sp|Q0IJ29|ZBT18_XENTR Zinc finger and BTB domain-containing protein 18 OS=Xenopus tropicalis GN=zbtb18 PE=2 SV=1 515 566 2.0E-07
sp|P07247|KRUP_DROME Protein krueppel OS=Drosophila melanogaster GN=Kr PE=1 SV=2 515 566 2.0E-07
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 509 566 2.0E-07
sp|Q0VDT2|ZN367_MOUSE Zinc finger protein 367 OS=Mus musculus GN=Znf367 PE=1 SV=2 489 566 2.0E-07
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 515 566 2.0E-07
sp|O43474|KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens GN=KLF4 PE=1 SV=3 510 564 2.0E-07
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 509 566 2.0E-07
sp|Q5T0B9|ZN362_HUMAN Zinc finger protein 362 OS=Homo sapiens GN=ZNF362 PE=1 SV=1 518 567 2.0E-07
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 483 566 2.0E-07
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 518 564 2.0E-07
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 513 566 2.0E-07
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 491 575 2.0E-07
sp|O73689|ZIC1_XENLA Zinc finger protein ZIC 1 OS=Xenopus laevis GN=zic1 PE=2 SV=1 499 566 2.0E-07
sp|Q96C28|ZN707_HUMAN Zinc finger protein 707 OS=Homo sapiens GN=ZNF707 PE=1 SV=2 515 564 2.0E-07
sp|Q5U2Z0|ZN367_RAT Zinc finger protein 367 OS=Rattus norvegicus GN=Znf367 PE=2 SV=1 489 566 2.0E-07
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 518 566 2.0E-07
sp|Q8JJC0|ZIC1_CHICK Zinc finger protein ZIC 1 OS=Gallus gallus GN=ZIC1 PE=1 SV=1 499 566 2.0E-07
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 498 566 2.0E-07
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 483 566 2.0E-07
sp|Q99M85|SCRT1_MOUSE Transcriptional repressor scratch 1 OS=Mus musculus GN=Scrt1 PE=1 SV=1 511 564 2.0E-07
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 517 566 2.0E-07
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 469 566 2.0E-07
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 518 566 2.0E-07
sp|Q5RE50|ZN215_PONAB Zinc finger protein 215 OS=Pongo abelii GN=ZNF215 PE=2 SV=1 518 566 2.0E-07
sp|P15621|ZNF44_HUMAN Zinc finger protein 44 OS=Homo sapiens GN=ZNF44 PE=2 SV=3 509 566 2.0E-07
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 509 566 2.0E-07
sp|Q8BZ34|ZN641_MOUSE Zinc finger protein 641 OS=Mus musculus GN=Znf641 PE=2 SV=1 505 571 2.0E-07
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 518 567 2.0E-07
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 495 567 2.0E-07
sp|A2A935|PRD16_MOUSE PR domain zinc finger protein 16 OS=Mus musculus GN=Prdm16 PE=1 SV=1 518 566 2.0E-07
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 493 566 2.0E-07
sp|Q7ZWZ4|ZB182_XENLA Zinc finger and BTB domain-containing protein 18.2 OS=Xenopus laevis GN=zbtb18.2 PE=2 SV=2 512 566 2.0E-07
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 518 564 2.0E-07
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 513 566 3.0E-07
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 509 566 3.0E-07
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 517 566 3.0E-07
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 518 566 3.0E-07
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 518 566 3.0E-07
sp|Q4R8H9|ZN274_MACFA Neurotrophin receptor-interacting factor homolog OS=Macaca fascicularis GN=ZNF274 PE=2 SV=1 493 566 3.0E-07
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 518 566 3.0E-07
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 518 566 3.0E-07
sp|Q9Y2Q1|ZN257_HUMAN Zinc finger protein 257 OS=Homo sapiens GN=ZNF257 PE=2 SV=2 510 566 3.0E-07
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 518 565 3.0E-07
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 499 566 3.0E-07
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 509 566 3.0E-07
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 499 566 3.0E-07
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 518 566 3.0E-07
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 518 566 3.0E-07
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 518 566 3.0E-07
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 483 564 3.0E-07
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 483 564 3.0E-07
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 518 566 3.0E-07
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 518 566 3.0E-07
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 515 563 3.0E-07
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 518 566 3.0E-07
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 518 564 3.0E-07
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 518 566 3.0E-07
sp|Q96MX3|ZNF48_HUMAN Zinc finger protein 48 OS=Homo sapiens GN=ZNF48 PE=1 SV=2 509 566 3.0E-07
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 476 566 3.0E-07
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 518 567 3.0E-07
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 518 566 3.0E-07
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 509 566 3.0E-07
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 514 563 3.0E-07
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 500 567 3.0E-07
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 518 567 3.0E-07
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 504 577 3.0E-07
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 518 573 3.0E-07
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 518 563 3.0E-07
sp|Q8BZ34|ZN641_MOUSE Zinc finger protein 641 OS=Mus musculus GN=Znf641 PE=2 SV=1 509 563 3.0E-07
sp|Q9HAZ2|PRD16_HUMAN PR domain zinc finger protein 16 OS=Homo sapiens GN=PRDM16 PE=1 SV=3 518 566 3.0E-07
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 518 566 3.0E-07
sp|Q8I7Z8|HAM_DROME Transcription factor hamlet OS=Drosophila melanogaster GN=ham PE=2 SV=1 511 566 3.0E-07
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 518 566 3.0E-07
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 518 567 3.0E-07
sp|Q0IHB8|OSR2B_XENLA Protein odd-skipped-related 2-B OS=Xenopus laevis GN=osr2-b PE=2 SV=1 518 566 3.0E-07
sp|Q96N77|ZN641_HUMAN Zinc finger protein 641 OS=Homo sapiens GN=ZNF641 PE=1 SV=2 505 563 3.0E-07
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 508 572 3.0E-07
sp|Q32NK7|OSR2A_XENLA Protein odd-skipped-related 2-A OS=Xenopus laevis GN=osr2-a PE=2 SV=1 518 566 3.0E-07
sp|Q9H963|ZN702_HUMAN Putative zinc finger protein 702 OS=Homo sapiens GN=ZNF702P PE=5 SV=2 496 566 3.0E-07
sp|P46684|ZIC1_MOUSE Zinc finger protein ZIC 1 OS=Mus musculus GN=Zic1 PE=1 SV=2 498 566 3.0E-07
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 518 567 3.0E-07
sp|Q9Z1D9|ZN394_MOUSE Zinc finger protein 394 OS=Mus musculus GN=Znf394 PE=2 SV=3 518 566 3.0E-07
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 518 566 3.0E-07
sp|Q15915|ZIC1_HUMAN Zinc finger protein ZIC 1 OS=Homo sapiens GN=ZIC1 PE=2 SV=2 498 566 3.0E-07
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 518 566 3.0E-07
sp|Q8N8C0|ZN781_HUMAN Zinc finger protein 781 OS=Homo sapiens GN=ZNF781 PE=2 SV=1 518 611 3.0E-07
sp|A8MWA4|Z705E_HUMAN Putative zinc finger protein 705E OS=Homo sapiens GN=ZNF705E PE=3 SV=1 504 571 3.0E-07
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 518 566 3.0E-07
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 518 564 3.0E-07
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 513 566 3.0E-07
sp|P56270|MAZ_HUMAN Myc-associated zinc finger protein OS=Homo sapiens GN=MAZ PE=1 SV=1 509 563 3.0E-07
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 513 566 3.0E-07
sp|P56671|MAZ_MOUSE Myc-associated zinc finger protein OS=Mus musculus GN=Maz PE=1 SV=1 509 563 3.0E-07
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 518 572 3.0E-07
sp|P98182|ZN200_HUMAN Zinc finger protein 200 OS=Homo sapiens GN=ZNF200 PE=2 SV=2 511 566 3.0E-07
sp|O75840|KLF7_HUMAN Krueppel-like factor 7 OS=Homo sapiens GN=KLF7 PE=2 SV=1 479 563 3.0E-07
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 518 563 3.0E-07
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 509 566 3.0E-07
sp|Q03112|EVI1_HUMAN MDS1 and EVI1 complex locus protein EVI1 OS=Homo sapiens GN=MECOM PE=1 SV=2 518 566 3.0E-07
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 518 572 3.0E-07
sp|P17022|ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens GN=ZNF18 PE=1 SV=2 509 563 3.0E-07
sp|Q6ZTB9|ZN833_HUMAN Putative zinc finger protein 833 OS=Homo sapiens GN=ZNF833P PE=5 SV=1 518 566 3.0E-07
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 518 563 3.0E-07
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 518 566 4.0E-07
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 508 566 4.0E-07
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 518 566 4.0E-07
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 518 566 4.0E-07
sp|Q3SY56|SP6_HUMAN Transcription factor Sp6 OS=Homo sapiens GN=SP6 PE=2 SV=1 518 563 4.0E-07
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 518 566 4.0E-07
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 518 566 4.0E-07
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 518 566 4.0E-07
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 518 566 4.0E-07
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 518 566 4.0E-07
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 518 566 4.0E-07
sp|Q49A33|Z876P_HUMAN Putative zinc finger protein 876 OS=Homo sapiens GN=ZNF876P PE=5 SV=3 503 564 4.0E-07
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 518 566 4.0E-07
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 518 566 4.0E-07
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 476 566 4.0E-07
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 515 566 4.0E-07
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 518 572 4.0E-07
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 518 564 4.0E-07
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 518 567 4.0E-07
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 509 564 4.0E-07
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 518 564 4.0E-07
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 518 566 4.0E-07
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 518 563 4.0E-07
sp|Q08DS3|OSR1_BOVIN Protein odd-skipped-related 1 OS=Bos taurus GN=OSR1 PE=2 SV=2 518 566 4.0E-07
sp|P14404|EVI1_MOUSE MDS1 and EVI1 complex locus protein EVI1 OS=Mus musculus GN=Mecom PE=1 SV=1 518 566 4.0E-07
sp|P0C6P6|TYY2_RAT Transcription factor YY2 OS=Rattus norvegicus GN=Yy2 PE=3 SV=1 509 565 4.0E-07
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 478 566 4.0E-07
sp|B7ZRU9|EVI1A_XENLA MDS1 and EVI1 complex locus protein EVI1-A OS=Xenopus laevis GN=mecom-a PE=1 SV=1 518 566 4.0E-07
sp|Q2FAY8|TYY2_RATRT Transcription factor YY2 OS=Rattus rattus GN=Yy2 PE=3 SV=1 509 565 4.0E-07
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 354 587 4.0E-07
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 513 566 4.0E-07
sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens GN=ZIC3 PE=1 SV=1 499 566 4.0E-07
sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens GN=ZIC3 PE=1 SV=1 513 566 4.0E-07
sp|Q8N883|ZN614_HUMAN Zinc finger protein 614 OS=Homo sapiens GN=ZNF614 PE=1 SV=2 518 583 4.0E-07
sp|O14771|ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens GN=ZNF213 PE=2 SV=2 509 566 4.0E-07
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 518 566 4.0E-07
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 518 563 4.0E-07
sp|Q62521|ZIC3_MOUSE Zinc finger protein ZIC 3 OS=Mus musculus GN=Zic3 PE=1 SV=2 499 566 4.0E-07
sp|Q62521|ZIC3_MOUSE Zinc finger protein ZIC 3 OS=Mus musculus GN=Zic3 PE=1 SV=2 513 566 4.0E-07
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 518 566 4.0E-07
sp|Q3TTC2|TYY2_MOUSE Transcription factor YY2 OS=Mus musculus GN=Yy2 PE=2 SV=1 509 565 4.0E-07
sp|Q8TAX0|OSR1_HUMAN Protein odd-skipped-related 1 OS=Homo sapiens GN=OSR1 PE=2 SV=1 518 566 4.0E-07
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 503 572 4.0E-07
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 354 587 4.0E-07
sp|Q5RCJ2|ZN614_PONAB Zinc finger protein 614 OS=Pongo abelii GN=ZNF614 PE=2 SV=1 518 583 4.0E-07
sp|Q9BWW7|SCRT1_HUMAN Transcriptional repressor scratch 1 OS=Homo sapiens GN=SCRT1 PE=1 SV=1 511 564 4.0E-07
sp|Q9Y4X4|KLF12_HUMAN Krueppel-like factor 12 OS=Homo sapiens GN=KLF12 PE=1 SV=2 481 563 4.0E-07
sp|O95600|KLF8_HUMAN Krueppel-like factor 8 OS=Homo sapiens GN=KLF8 PE=1 SV=2 509 563 4.0E-07
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 518 567 5.0E-07
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 518 567 5.0E-07
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 494 566 5.0E-07
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 518 564 5.0E-07
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 518 566 5.0E-07
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 518 566 5.0E-07
sp|P46099|KLF1_MOUSE Krueppel-like factor 1 OS=Mus musculus GN=Klf1 PE=1 SV=2 509 563 5.0E-07
sp|Q9ESX2|SP6_MOUSE Transcription factor Sp6 OS=Mus musculus GN=Sp6 PE=2 SV=2 518 563 5.0E-07
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 518 566 5.0E-07
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 518 566 5.0E-07
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 518 572 5.0E-07
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 518 566 5.0E-07
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 518 566 5.0E-07
sp|Q60793|KLF4_MOUSE Krueppel-like factor 4 OS=Mus musculus GN=Klf4 PE=1 SV=3 509 563 5.0E-07
sp|Q15929|ZNF56_HUMAN Putative zinc finger protein 56 OS=Homo sapiens GN=ZNF56 PE=5 SV=2 518 566 5.0E-07
sp|Q8JJC0|ZIC1_CHICK Zinc finger protein ZIC 1 OS=Gallus gallus GN=ZIC1 PE=1 SV=1 505 566 5.0E-07
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 518 567 5.0E-07
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 507 566 5.0E-07
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 518 566 5.0E-07
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 501 566 5.0E-07
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 509 566 5.0E-07
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 509 566 5.0E-07
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 507 565 5.0E-07
sp|O95600|KLF8_HUMAN Krueppel-like factor 8 OS=Homo sapiens GN=KLF8 PE=1 SV=2 509 564 5.0E-07
sp|Q7TQ40|ZIC5_MOUSE Zinc finger protein ZIC 5 OS=Mus musculus GN=Zic5 PE=1 SV=1 509 566 6.0E-07
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 513 564 6.0E-07
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 513 564 6.0E-07
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 502 566 6.0E-07
sp|Q29W20|EGR1_BOVIN Early growth response protein 1 OS=Bos taurus GN=EGR1 PE=2 SV=1 520 566 6.0E-07
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 518 566 6.0E-07
sp|Q3US17|ZNF48_MOUSE Zinc finger protein 48 OS=Mus musculus GN=Znf48 PE=1 SV=2 503 564 6.0E-07
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 518 566 6.0E-07
sp|O73689|ZIC1_XENLA Zinc finger protein ZIC 1 OS=Xenopus laevis GN=zic1 PE=2 SV=1 505 566 6.0E-07
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 518 565 6.0E-07
sp|Q96N77|ZN641_HUMAN Zinc finger protein 641 OS=Homo sapiens GN=ZNF641 PE=1 SV=2 511 563 6.0E-07
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 518 566 6.0E-07
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 481 566 7.0E-07
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 518 566 7.0E-07
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 518 566 7.0E-07
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 518 566 7.0E-07
sp|Q4V8E9|NRIF1_RAT Neurotrophin receptor-interacting factor 1 OS=Rattus norvegicus GN=Nrif1 PE=2 SV=1 471 572 7.0E-07
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 518 566 7.0E-07
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 518 566 7.0E-07
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 518 566 7.0E-07
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 518 566 7.0E-07
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 518 566 7.0E-07
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 513 566 7.0E-07
sp|O88553|ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus GN=Zfp37 PE=2 SV=1 518 564 7.0E-07
sp|Q96T25|ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens GN=ZIC5 PE=1 SV=2 509 566 7.0E-07
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 518 567 7.0E-07
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 509 564 7.0E-07
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 509 566 7.0E-07
sp|P46684|ZIC1_MOUSE Zinc finger protein ZIC 1 OS=Mus musculus GN=Zic1 PE=1 SV=2 505 566 7.0E-07
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 503 566 7.0E-07
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 518 566 7.0E-07
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 518 566 7.0E-07
sp|Q9Y4X4|KLF12_HUMAN Krueppel-like factor 12 OS=Homo sapiens GN=KLF12 PE=1 SV=2 509 564 7.0E-07
sp|Q15973|ZN124_HUMAN Zinc finger protein 124 OS=Homo sapiens GN=ZNF124 PE=1 SV=2 518 566 8.0E-07
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 518 566 8.0E-07
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 476 566 8.0E-07
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 513 564 8.0E-07
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 517 565 8.0E-07
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 517 565 8.0E-07
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 513 564 8.0E-07
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 518 575 8.0E-07
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 518 566 8.0E-07
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 509 566 8.0E-07
sp|O43474|KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens GN=KLF4 PE=1 SV=3 509 563 8.0E-07
sp|Q15915|ZIC1_HUMAN Zinc finger protein ZIC 1 OS=Homo sapiens GN=ZIC1 PE=2 SV=2 505 566 8.0E-07
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 518 566 8.0E-07
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 476 566 9.0E-07
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 518 572 9.0E-07
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 511 564 9.0E-07
sp|Q9BZE0|GLIS2_HUMAN Zinc finger protein GLIS2 OS=Homo sapiens GN=GLIS2 PE=1 SV=2 519 566 9.0E-07
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 515 564 9.0E-07
sp|Q4R8H9|ZN274_MACFA Neurotrophin receptor-interacting factor homolog OS=Macaca fascicularis GN=ZNF274 PE=2 SV=1 504 566 9.0E-07
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 518 566 9.0E-07
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 518 566 9.0E-07
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 513 564 9.0E-07
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 518 566 9.0E-07
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 518 566 9.0E-07
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 518 566 9.0E-07
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 518 566 9.0E-07
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 518 566 9.0E-07
sp|Q9ET58|KLF2_RAT Krueppel-like factor 2 OS=Rattus norvegicus GN=Klf2 PE=1 SV=1 509 563 9.0E-07
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 518 566 9.0E-07
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 518 566 9.0E-07
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 518 572 9.0E-07
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 518 567 9.0E-07
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 513 566 9.0E-07
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 479 566 9.0E-07
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 511 564 1.0E-06
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 514 569 1.0E-06
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 518 566 1.0E-06
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 511 564 1.0E-06
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 515 598 1.0E-06
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 518 566 1.0E-06
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 509 564 1.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 518 566 1.0E-06
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 509 564 1.0E-06
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 518 566 1.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 518 566 1.0E-06
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 518 572 1.0E-06
sp|Q9P2F9|ZN319_HUMAN Zinc finger protein 319 OS=Homo sapiens GN=ZNF319 PE=1 SV=2 515 566 1.0E-06
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 518 564 1.0E-06
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 518 566 1.0E-06
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 518 573 1.0E-06
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 509 566 1.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 518 573 1.0E-06
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 518 567 1.0E-06
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 518 566 1.0E-06
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 518 566 1.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 518 566 1.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 518 566 1.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 518 566 1.0E-06
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 518 566 1.0E-06
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 518 566 1.0E-06
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 518 567 1.0E-06
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 518 566 1.0E-06
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 517 565 1.0E-06
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 518 572 1.0E-06
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 513 564 1.0E-06
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 513 564 1.0E-06
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 518 566 1.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 518 566 1.0E-06
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 518 566 1.0E-06
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 518 566 1.0E-06
sp|Q60843|KLF2_MOUSE Krueppel-like factor 2 OS=Mus musculus GN=Klf2 PE=1 SV=2 509 563 1.0E-06
sp|Q60980|KLF3_MOUSE Krueppel-like factor 3 OS=Mus musculus GN=Klf3 PE=1 SV=1 485 564 1.0E-06
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 509 566 1.0E-06
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 518 567 1.0E-06
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 497 566 1.0E-06
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 501 566 1.0E-06
sp|P57682|KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens GN=KLF3 PE=1 SV=1 484 564 1.0E-06
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 518 566 1.0E-06
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 518 566 1.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 503 566 1.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 518 566 1.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 503 566 1.0E-06
sp|Q9NX65|ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens GN=ZSCAN32 PE=1 SV=3 491 566 1.0E-06
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 518 566 1.0E-06
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 518 567 1.0E-06
sp|Q6PDB4|ZN880_HUMAN Zinc finger protein 880 OS=Homo sapiens GN=ZNF880 PE=2 SV=2 509 566 1.0E-06
sp|Q6PDB4|ZN880_HUMAN Zinc finger protein 880 OS=Homo sapiens GN=ZNF880 PE=2 SV=2 501 566 1.0E-06
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 518 566 1.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 518 578 1.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 518 566 1.0E-06
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 511 564 1.0E-06
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 518 567 1.0E-06
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 518 566 1.0E-06
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 518 564 1.0E-06
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 518 567 1.0E-06
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 511 564 1.0E-06
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 518 567 1.0E-06
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 518 566 1.0E-06
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 518 566 1.0E-06
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 518 567 1.0E-06
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 518 566 1.0E-06
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 518 566 1.0E-06
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 505 567 1.0E-06
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 518 567 1.0E-06
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 507 567 1.0E-06
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 503 566 1.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 518 566 1.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 503 566 1.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 503 566 1.0E-06
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 518 566 1.0E-06
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 518 566 2.0E-06
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 518 566 2.0E-06
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 518 566 2.0E-06
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 445 566 2.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 476 566 2.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 518 566 2.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 518 566 2.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 476 566 2.0E-06
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 518 579 2.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 518 572 2.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 518 566 2.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 518 571 2.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 518 572 2.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 518 571 2.0E-06
sp|Q9ERR8|ZN319_MOUSE Zinc finger protein 319 OS=Mus musculus GN=Znf319 PE=2 SV=1 515 566 2.0E-06
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 518 563 2.0E-06
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 518 566 2.0E-06
sp|P41696|AZF1_YEAST Asparagine-rich zinc finger protein AZF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZF1 PE=1 SV=1 518 565 2.0E-06
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 518 571 2.0E-06
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 518 580 2.0E-06
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 517 566 2.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 517 566 2.0E-06
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 518 564 2.0E-06
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 515 567 2.0E-06
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 509 567 2.0E-06
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 518 616 2.0E-06
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 395 566 2.0E-06
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 518 565 2.0E-06
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 517 565 2.0E-06
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 518 566 2.0E-06
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 517 565 2.0E-06
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 518 580 2.0E-06
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 509 566 2.0E-06
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 514 563 2.0E-06
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 518 566 2.0E-06
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 518 566 2.0E-06
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 515 566 2.0E-06
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 518 566 2.0E-06
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 518 566 2.0E-06
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 518 566 2.0E-06
sp|Q5HY98|ZN766_HUMAN Zinc finger protein 766 OS=Homo sapiens GN=ZNF766 PE=2 SV=1 518 566 2.0E-06
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 509 567 2.0E-06
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 509 566 2.0E-06
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 509 566 2.0E-06
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 518 566 2.0E-06
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 518 566 2.0E-06
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 515 566 2.0E-06
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 515 563 2.0E-06
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 483 584 2.0E-06
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 518 564 2.0E-06
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 515 567 2.0E-06
sp|Q9Y5W3|KLF2_HUMAN Krueppel-like factor 2 OS=Homo sapiens GN=KLF2 PE=1 SV=2 509 563 2.0E-06
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 518 573 2.0E-06
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 518 564 2.0E-06
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 504 566 2.0E-06
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 517 566 2.0E-06
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 515 567 2.0E-06
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 518 566 2.0E-06
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 518 564 2.0E-06
sp|Q8N8C0|ZN781_HUMAN Zinc finger protein 781 OS=Homo sapiens GN=ZNF781 PE=2 SV=1 509 567 2.0E-06
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 518 567 2.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 476 566 2.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 518 566 2.0E-06
sp|Q6ZTB9|ZN833_HUMAN Putative zinc finger protein 833 OS=Homo sapiens GN=ZNF833P PE=5 SV=1 518 566 2.0E-06
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 514 563 2.0E-06
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 500 566 2.0E-06
sp|O14771|ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens GN=ZNF213 PE=2 SV=2 504 566 2.0E-06
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 514 563 2.0E-06
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 518 566 3.0E-06
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 518 566 3.0E-06
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 484 564 3.0E-06
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 518 567 3.0E-06
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 518 566 3.0E-06
sp|Q98T94|GLIS2_XENLA Zinc finger protein GLIS2 OS=Xenopus laevis GN=glis2 PE=2 SV=1 519 566 3.0E-06
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 518 564 3.0E-06
sp|Q8VDL9|GLIS2_MOUSE Zinc finger protein GLIS2 OS=Mus musculus GN=Glis2 PE=1 SV=1 519 566 3.0E-06
sp|O08584|KLF6_MOUSE Krueppel-like factor 6 OS=Mus musculus GN=Klf6 PE=2 SV=3 509 564 3.0E-06
sp|O35819|KLF6_RAT Krueppel-like factor 6 OS=Rattus norvegicus GN=Klf6 PE=2 SV=2 509 564 3.0E-06
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 518 566 3.0E-06
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 518 566 3.0E-06
sp|O15090|ZN536_HUMAN Zinc finger protein 536 OS=Homo sapiens GN=ZNF536 PE=1 SV=3 509 563 3.0E-06
sp|Q8K083|ZN536_MOUSE Zinc finger protein 536 OS=Mus musculus GN=Znf536 PE=2 SV=1 509 563 3.0E-06
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 518 564 3.0E-06
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 517 563 3.0E-06
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 518 566 3.0E-06
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 504 566 3.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 518 566 3.0E-06
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 514 566 3.0E-06
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 518 566 3.0E-06
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 514 566 3.0E-06
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 517 566 3.0E-06
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 518 566 3.0E-06
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 518 566 3.0E-06
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 504 566 3.0E-06
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 477 566 3.0E-06
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 518 566 3.0E-06
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 504 566 3.0E-06
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 518 566 3.0E-06
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 518 566 3.0E-06
sp|O88553|ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus GN=Zfp37 PE=2 SV=1 509 566 3.0E-06
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 515 567 3.0E-06
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 509 566 3.0E-06
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 518 573 3.0E-06
sp|Q15929|ZNF56_HUMAN Putative zinc finger protein 56 OS=Homo sapiens GN=ZNF56 PE=5 SV=2 518 564 3.0E-06
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 518 566 3.0E-06
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 509 567 3.0E-06
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 518 566 3.0E-06
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 518 566 3.0E-06
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 518 566 3.0E-06
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 518 572 3.0E-06
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 515 567 3.0E-06
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 518 566 3.0E-06
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 518 566 3.0E-06
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 499 567 3.0E-06
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 518 567 3.0E-06
sp|O75840|KLF7_HUMAN Krueppel-like factor 7 OS=Homo sapiens GN=KLF7 PE=2 SV=1 509 564 3.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 518 566 3.0E-06
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 509 566 4.0E-06
sp|P49910|ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens GN=ZNF165 PE=1 SV=1 518 605 4.0E-06
sp|Q921B4|NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus GN=Nrif2 PE=1 SV=1 518 566 4.0E-06
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 515 566 4.0E-06
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 518 566 4.0E-06
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 500 566 4.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 518 566 4.0E-06
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 502 566 4.0E-06
sp|Q3SXZ3|ZN718_HUMAN Zinc finger protein 718 OS=Homo sapiens GN=ZNF718 PE=2 SV=1 518 566 4.0E-06
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 509 566 4.0E-06
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 509 566 4.0E-06
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 518 567 4.0E-06
sp|Q966L8|CHE1_CAEEL Transcription factor che-1 OS=Caenorhabditis elegans GN=che-1 PE=1 SV=3 515 564 4.0E-06
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 491 566 4.0E-06
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 491 566 4.0E-06
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 518 563 4.0E-06
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 518 564 4.0E-06
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 518 566 4.0E-06
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 518 566 4.0E-06
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 518 566 4.0E-06
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 518 566 4.0E-06
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 518 566 4.0E-06
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 509 566 4.0E-06
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 504 566 4.0E-06
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 504 566 4.0E-06
sp|Q15935|ZNF77_HUMAN Zinc finger protein 77 OS=Homo sapiens GN=ZNF77 PE=2 SV=2 518 567 4.0E-06
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 518 566 4.0E-06
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 518 566 4.0E-06
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 484 579 4.0E-06
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 508 566 4.0E-06
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 501 566 4.0E-06
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 518 566 4.0E-06
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 514 566 4.0E-06
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 518 567 4.0E-06
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 518 566 4.0E-06
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 457 566 4.0E-06
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 513 564 4.0E-06
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 457 566 4.0E-06
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 513 564 4.0E-06
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 518 566 4.0E-06
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 513 564 4.0E-06
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 490 566 4.0E-06
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 518 566 4.0E-06
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 518 566 4.0E-06
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 518 566 5.0E-06
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 518 566 5.0E-06
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 509 566 5.0E-06
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 478 567 5.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 518 566 5.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 518 566 5.0E-06
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 483 564 5.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 518 566 5.0E-06
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 518 566 5.0E-06
sp|Q99612|KLF6_HUMAN Krueppel-like factor 6 OS=Homo sapiens GN=KLF6 PE=1 SV=3 509 564 5.0E-06
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 518 566 5.0E-06
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 518 563 5.0E-06
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 509 563 5.0E-06
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 518 566 5.0E-06
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 518 566 5.0E-06
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 501 573 5.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 518 566 5.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 518 566 5.0E-06
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 518 566 5.0E-06
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 515 563 5.0E-06
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 518 576 5.0E-06
sp|Q3U3I9|ZN865_MOUSE Zinc finger protein 865 OS=Mus musculus GN=Znf865 PE=2 SV=1 442 564 5.0E-06
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 492 563 5.0E-06
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 518 566 5.0E-06
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 492 563 5.0E-06
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 518 566 5.0E-06
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 518 567 5.0E-06
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 509 566 5.0E-06
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 509 566 5.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 515 564 5.0E-06
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 518 566 5.0E-06
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 518 573 5.0E-06
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 518 566 5.0E-06
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 448 566 5.0E-06
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 518 567 5.0E-06
sp|P15621|ZNF44_HUMAN Zinc finger protein 44 OS=Homo sapiens GN=ZNF44 PE=2 SV=3 482 566 5.0E-06
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 518 566 5.0E-06
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 518 567 5.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 508 566 5.0E-06
sp|P17022|ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens GN=ZNF18 PE=1 SV=2 513 566 5.0E-06
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 500 566 5.0E-06
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 518 566 6.0E-06
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 509 566 6.0E-06
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 507 566 6.0E-06
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 518 567 6.0E-06
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 518 572 6.0E-06
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 483 564 6.0E-06
sp|Q9Y2Q1|ZN257_HUMAN Zinc finger protein 257 OS=Homo sapiens GN=ZNF257 PE=2 SV=2 500 566 6.0E-06
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 518 566 6.0E-06
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 508 566 6.0E-06
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 518 566 6.0E-06
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 518 566 6.0E-06
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 518 566 6.0E-06
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 504 566 6.0E-06
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 518 566 6.0E-06
sp|Q9Y2A4|ZN443_HUMAN Zinc finger protein 443 OS=Homo sapiens GN=ZNF443 PE=2 SV=2 496 566 6.0E-06
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 518 566 6.0E-06
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 518 566 6.0E-06
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 518 577 6.0E-06
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 518 566 6.0E-06
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 518 566 6.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 518 566 6.0E-06
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 515 563 6.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 518 566 6.0E-06
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 509 566 6.0E-06
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 474 572 6.0E-06
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 518 567 6.0E-06
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 509 566 7.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 518 566 7.0E-06
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 518 566 7.0E-06
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 517 566 7.0E-06
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 483 566 7.0E-06
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 518 566 7.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 518 566 7.0E-06
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 514 563 7.0E-06
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 518 566 7.0E-06
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 509 566 7.0E-06
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 518 566 7.0E-06
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 396 567 7.0E-06
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 518 567 7.0E-06
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 515 566 7.0E-06
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 515 563 7.0E-06
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 518 566 7.0E-06
sp|A2A935|PRD16_MOUSE PR domain zinc finger protein 16 OS=Mus musculus GN=Prdm16 PE=1 SV=1 486 564 7.0E-06
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 509 566 7.0E-06
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 518 567 7.0E-06
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 509 562 7.0E-06
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 518 567 7.0E-06
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 517 566 7.0E-06
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 509 562 7.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 518 566 7.0E-06
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 509 566 8.0E-06
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 518 564 8.0E-06
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 517 566 8.0E-06
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 509 572 8.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 518 566 8.0E-06
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 509 572 8.0E-06
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 518 566 8.0E-06
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 518 566 8.0E-06
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 518 564 8.0E-06
sp|B4DX44|ZN736_HUMAN Zinc finger protein 736 OS=Homo sapiens GN=ZNF736 PE=2 SV=2 518 564 8.0E-06
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 509 566 8.0E-06
sp|P0CJ78|ZN865_HUMAN Zinc finger protein 865 OS=Homo sapiens GN=ZNF865 PE=3 SV=1 515 564 8.0E-06
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 515 566 8.0E-06
sp|Q96C28|ZN707_HUMAN Zinc finger protein 707 OS=Homo sapiens GN=ZNF707 PE=1 SV=2 508 566 8.0E-06
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 518 566 8.0E-06
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 509 562 8.0E-06
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 518 566 9.0E-06
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 518 566 9.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 518 566 9.0E-06
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 518 566 9.0E-06
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 509 572 9.0E-06
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 509 566 9.0E-06
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 518 564 9.0E-06
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 518 564 9.0E-06
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 518 566 9.0E-06
sp|Q96MX3|ZNF48_HUMAN Zinc finger protein 48 OS=Homo sapiens GN=ZNF48 PE=1 SV=2 518 566 9.0E-06
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 518 566 9.0E-06
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 518 566 9.0E-06
sp|A6QNZ0|ZSC26_BOVIN Zinc finger and SCAN domain-containing protein 26 OS=Bos taurus GN=ZSCAN26 PE=2 SV=1 509 566 9.0E-06
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 518 566 9.0E-06
sp|Q9HAZ2|PRD16_HUMAN PR domain zinc finger protein 16 OS=Homo sapiens GN=PRDM16 PE=1 SV=3 509 564 9.0E-06
sp|Q03112|EVI1_HUMAN MDS1 and EVI1 complex locus protein EVI1 OS=Homo sapiens GN=MECOM PE=1 SV=2 485 564 9.0E-06
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 518 566 1.0E-05
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 515 564 1.0E-05
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 509 572 1.0E-05
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 509 573 1.0E-05
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 513 564 1.0E-05
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 518 564 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0003700 DNA-binding transcription factor activity Yes
GO:0005634 nucleus Yes
GO:0080090 regulation of primary metabolic process No
GO:0008150 biological_process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0019222 regulation of metabolic process No
GO:0050794 regulation of cellular process No
GO:0140110 transcription regulator activity No
GO:0031323 regulation of cellular metabolic process No
GO:0065007 biological regulation No
GO:0010468 regulation of gene expression No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0043227 membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0009889 regulation of biosynthetic process No
GO:0050789 regulation of biological process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0051252 regulation of RNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
STE like TF
C2H2 zinc finger

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2979
MYSQHGAMAPQKPETFMLSTEAQQALPHDAQVALQQVDNLKYFLISAPVDWQPDQYIRRFLLPTGEYVSCVLWNN
LFHISGTDIVRCLSFRFQAFGRPVKNSKKFEEGIFSDLRNLKSGTDASLEEPKSAFLDFLYKNNCIRTQKKQKVF
YWYSVPHDRLFLDALERDLKREKMGQEATTVAVSEPALSFQYDSSQSLYEQLTKTQQANSSSFSAQQPAFPPVHG
PLTGGHGPNGTYNQNGVPMTHGHQRHASMPPYGLEYSPAPSFVSSQYEDYSNRGISFEPITPPQQALGMAGEPAY
IANEETGLYSAIPDHVPGMNGLNGVGQLPPSSMPGSQFNRSYGANNVYSVIEGSPTYKQRRRRSSIPPSVSGMAG
PPVANAAAAAAAHRPSDLRRSVSTSVGPVPEGDESTGNSPPGLAYSASGASLTSQPHKDMVDMSRHGTPLSTVDG
SPALNPMALHQDFSQVPPDEYAGGDASLKGHRRNVSGPNGVVRRARSATVMELGPYPHKSHSCPIPTCGRLFKRL
EHLKRHVRTHTQEKPYICPHCSKAFSRSDNLAQHKRTHSREDGGESSMNLSAEEEEELSDAGSSNMNESQSFNSL
QTLSMPMTISQPTTINGIM
Coding >Ophio5|2979
ATGTATTCTCAGCACGGAGCCATGGCTCCTCAGAAACCAGAGACCTTCATGCTGAGCACCGAAGCGCAGCAGGCA
TTGCCGCACGATGCTCAGGTCGCTCTCCAGCAGGTCGACAACCTCAAATACTTCCTCATCTCTGCCCCCGTCGAC
TGGCAGCCTGACCAGTACATCCGCCGCTTTCTCCTGCCCACGGGCGAGTACGTCTCTTGCGTCTTGTGGAACAAC
CTCTTTCACATCTCCGGCACCGACATCGTCCGATGCCTTTCCTTCCGCTTCCAGGCCTTTGGCCGTCCCGTCAAA
AACTCCAAAAAGTTCGAGGAGGGCATCTTCTCCGACCTGCGCAACCTCAAGTCGGGTACCGACGCCTCGCTTGAG
GAGCCCAAGAGCGCCTTTCTCGACTTCCTCTACAAGAACAACTGCATCCGCACCCAGAAGAAGCAAAAAGTCTTT
TACTGGTACAGCGTCCCCCATGACCGTCTCTTCCTCGACGCCCTCGAGCGCGACCTGAAGCGCGAGAAGATGGGC
CAGGAGGCCACCACCGTCGCCGTCAGCGAGCCCGCACTGTCCTTCCAATACGACTCGTCCCAGTCGCTGTACGAG
CAGCTCACCAAGACGCAACAAGCCAACTCGTCCTCCTTCAGCGCCCAGCAGCCCGCCTTCCCCCCGGTCCATGGC
CCCCTTACCGGAGGGCATGGACCCAATGGTACCTACAACCAGAACGGCGTCCCGATGACCCACGGCCACCAGCGC
CACGCGTCGATGCCGCCCTACGGCCTGGAGTACTCCCCCGCCCCCTCCTTCGTCTCGTCCCAGTACGAGGATTAC
AGCAACCGGGGCATTTCCTTCGAGCCCATCACTCCCCCCCAGCAGGCTCTGGGCATGGCCGGCGAGCCCGCCTAC
ATCGCCAACGAGGAGACGGGCCTCTACTCGGCCATTCCGGACCACGTTCCGGGCATGAATGGCCTCAATGGCGTC
GGTCAGCTGCCGCCTTCCAGCATGCCCGGCTCCCAATTCAACCGGTCCTACGGCGCCAACAACGTCTACTCCGTC
ATCGAGGGTTCGCCCACCTACAAGCAGAGGCGCCGCCGCTCCTCCATTCCGCCCTCCGTCTCCGGCATGGCCGGC
CCCCCCGTCGCCAACGCCGCAGCCGCCGCAGCCGCACACCGGCCTTCGGACCTGAGGAGGTCCGTCTCGACGTCG
GTCGGCCCGGTCCCCGAGGGCGACGAGTCGACGGGCAATTCGCCACCCGGCCTCGCCTACAGCGCCTCGGGCGCG
TCCCTGACGAGCCAGCCGCACAAGGACATGGTCGACATGTCCCGCCACGGCACGCCCCTCTCCACCGTCGACGGC
AGCCCGGCCCTCAACCCCATGGCCTTGCACCAGGACTTCTCTCAGGTGCCTCCGGACGAATACGCCGGCGGCGAC
GCGTCCCTCAAGGGCCATCGCCGCAACGTGTCCGGTCCCAACGGCGTCGTCCGCCGAGCGCGCTCCGCCACCGTC
ATGGAGCTGGGTCCGTACCCGCACAAGTCGCACTCTTGCCCCATCCCGACCTGCGGTCGCCTGTTCAAGCGGTTA
GAGCACCTGAAGCGACACGTGAGGACGCACACGCAAGAGAAGCCCTACATCTGCCCGCACTGCAGCAAAGCCTTT
TCCCGATCAGACAATCTGGCACAACACAAGCGCACGCACAGTCGCGAGGATGGTGGCGAGAGCTCGATGAACTTG
TCGGCTGAAGAGGAGGAGGAGCTGTCTGACGCCGGTTCCAGCAACATGAACGAGAGTCAGAGCTTCAACAGCCTG
CAAACACTGAGCATGCCCATGACTATCAGTCAACCGACCACGATCAACGGCATTATG
Transcript >Ophio5|2979
ATGTATTCTCAGCACGGAGCCATGGCTCCTCAGAAACCAGAGACCTTCATGCTGAGCACCGAAGCGCAGCAGGCA
TTGCCGCACGATGCTCAGGTCGCTCTCCAGCAGGTCGACAACCTCAAATACTTCCTCATCTCTGCCCCCGTCGAC
TGGCAGCCTGACCAGTACATCCGCCGCTTTCTCCTGCCCACGGGCGAGTACGTCTCTTGCGTCTTGTGGAACAAC
CTCTTTCACATCTCCGGCACCGACATCGTCCGATGCCTTTCCTTCCGCTTCCAGGCCTTTGGCCGTCCCGTCAAA
AACTCCAAAAAGTTCGAGGAGGGCATCTTCTCCGACCTGCGCAACCTCAAGTCGGGTACCGACGCCTCGCTTGAG
GAGCCCAAGAGCGCCTTTCTCGACTTCCTCTACAAGAACAACTGCATCCGCACCCAGAAGAAGCAAAAAGTCTTT
TACTGGTACAGCGTCCCCCATGACCGTCTCTTCCTCGACGCCCTCGAGCGCGACCTGAAGCGCGAGAAGATGGGC
CAGGAGGCCACCACCGTCGCCGTCAGCGAGCCCGCACTGTCCTTCCAATACGACTCGTCCCAGTCGCTGTACGAG
CAGCTCACCAAGACGCAACAAGCCAACTCGTCCTCCTTCAGCGCCCAGCAGCCCGCCTTCCCCCCGGTCCATGGC
CCCCTTACCGGAGGGCATGGACCCAATGGTACCTACAACCAGAACGGCGTCCCGATGACCCACGGCCACCAGCGC
CACGCGTCGATGCCGCCCTACGGCCTGGAGTACTCCCCCGCCCCCTCCTTCGTCTCGTCCCAGTACGAGGATTAC
AGCAACCGGGGCATTTCCTTCGAGCCCATCACTCCCCCCCAGCAGGCTCTGGGCATGGCCGGCGAGCCCGCCTAC
ATCGCCAACGAGGAGACGGGCCTCTACTCGGCCATTCCGGACCACGTTCCGGGCATGAATGGCCTCAATGGCGTC
GGTCAGCTGCCGCCTTCCAGCATGCCCGGCTCCCAATTCAACCGGTCCTACGGCGCCAACAACGTCTACTCCGTC
ATCGAGGGTTCGCCCACCTACAAGCAGAGGCGCCGCCGCTCCTCCATTCCGCCCTCCGTCTCCGGCATGGCCGGC
CCCCCCGTCGCCAACGCCGCAGCCGCCGCAGCCGCACACCGGCCTTCGGACCTGAGGAGGTCCGTCTCGACGTCG
GTCGGCCCGGTCCCCGAGGGCGACGAGTCGACGGGCAATTCGCCACCCGGCCTCGCCTACAGCGCCTCGGGCGCG
TCCCTGACGAGCCAGCCGCACAAGGACATGGTCGACATGTCCCGCCACGGCACGCCCCTCTCCACCGTCGACGGC
AGCCCGGCCCTCAACCCCATGGCCTTGCACCAGGACTTCTCTCAGGTGCCTCCGGACGAATACGCCGGCGGCGAC
GCGTCCCTCAAGGGCCATCGCCGCAACGTGTCCGGTCCCAACGGCGTCGTCCGCCGAGCGCGCTCCGCCACCGTC
ATGGAGCTGGGTCCGTACCCGCACAAGTCGCACTCTTGCCCCATCCCGACCTGCGGTCGCCTGTTCAAGCGGTTA
GAGCACCTGAAGCGACACGTGAGGACGCACACGCAAGAGAAGCCCTACATCTGCCCGCACTGCAGCAAAGCCTTT
TCCCGATCAGACAATCTGGCACAACACAAGCGCACGCACAGTCGCGAGGATGGTGGCGAGAGCTCGATGAACTTG
TCGGCTGAAGAGGAGGAGGAGCTGTCTGACGCCGGTTCCAGCAACATGAACGAGAGTCAGAGCTTCAACAGCCTG
CAAACACTGAGCATGCCCATGACTATCAGTCAACCGACCACGATCAACGGCATTATGTAA
Gene >Ophio5|2979
ATGTATTCTCAGCACGGAGCCATGGCTCCTCAGAAACCAGAGACCTTCATGCTGAGCACCGAAGCGCAGCAGGCA
TTGCCGCACGATGCTCAGGTCGCTCTCCAGCAGGTCGACAACCGTCAGTGGCCCCCCCCCCCCCCCCCCCGTCTC
CTCCTCTCCTCCTCTCCAATTCGCCGCTCTGGCTGACTCGTGTCGACGTCCAGTCAAATACTTCCTCATCTCTGC
CCCCGTCGACTGGCAGCCTGACCAGTACATCCGCCGCTTTCTCCTGCCCACGGGCGAGTACGTCTCTTGCGTCTT
GTGGTAGGTTGTTCTTCAGCTGCTTGTTGACAAGAAGACGGCTGACGCGTACAAGGAACAACCTCTTTCACATCT
CCGGCACCGACATCGTCCGATGCCTTTCCTTCCGCTTCCAGGCCTTTGGCCGTCCCGTCAAAAACTCCAAAAAGT
TCGAGGAGGGCATCTTCTCCGACCTGCGCAACCTCAAGTCGGGTACCGACGCCTCGCTTGAGGAGCCCAAGAGCG
CCTTTCTCGACTTCCTCTACAAGAACAACTGCATCCGCACCCAGAAGAAGCAAAAAGTCTTTTACTGGTACAGCG
TCCCCCATGACCGTCTCTTCCTCGACGCCCTCGAGCGCGACCTGAAGCGCGAGAAGATGGGCCAGGAGGCCACCA
CCGTCGCCGTCAGCGAGCCCGCACTGTCCTTCCAATACGACTCGTCCCAGTCGCTGTACGAGCAGCTCACCAAGA
CGCAACAAGCCAACTCGTCCTCCTTCAGCGCCCAGCAGCCCGCCTTCCCCCCGGGTCAGTCGTCGTCGCCCGTCA
TGAGAAACATGGACGCCATGCCCCCGCCCCACATGATGCCGCAGTCCATGGCCCCCTTACCGGAGGGCATGGACC
CAATGGTACCGTACGATTCGATGCCGATGCCGTCCGCTGTGACGCAGCAAGTTCAGCCCGTCAAGAGGGATCCTG
ACTTCGCCCGTGTCCAGTACAACCAGAACGGCGTCCCGATGACCCACGGCCACCAGCGCCACGCGTCGATGCCGC
CCTACGGCCTGGAGTACTCCCCCGCCCCCTCCTTCGTCTCGTCCCAGTACGAGGATTACAGCAACCGGGGCATTT
CCTTCGAGCCCATCACTCCCCCCCAGCAGGCTCTGGGCATGGCCGGCGAGCCCGCCTACATCGCCAACGAGGAGA
CGGGCCTCTACTCGGCCATTCCGGACCACGTTCCGGGCATGAATGGCCTCAATGGCGTCGGTCAGCTGCCGCCTT
CCAGCATGCCCGGCTCCCAATTCAACCGGTCCTACGGCGCCAACAACGTCTACTCCGTCATCGAGGGTTCGCCCA
CCTACAAGCAGAGGCGCCGCCGCTCCTCCATTCCGCCCTCCGTCTCCGGCATGGCCGGCCCCCCCGTCGCCAACG
CCGCAGCCGCCGCAGCCGCACACCGGCCTTCGGACCTGAGGAGGTCCGTCTCGACGTCGGTCGGCCCGGTCCCCG
AGGGCGACGAGTCGACGGGCAATTCGCCACCCGGCCTCGCCTACAGCGCCTCGGGCGCGTCCCTGACGAGCCAGC
CGCACAAGGACATGGTCGACATGTCCCGCCACGGCACGCCCCTCTCCACCGTCGACGGCAGCCCGGCCCTCAACC
CCATGGCCTTGCACCAGGACTTCTCTCAGGTGCCTCCGGACGAATACGCCGGCGGCGACGCGTCCCTCAAGGGCC
ATCGCCGCAACGTGTCCGGTCCCAACGGCGTCGTCCGCCGAGCGCGCTCCGCCACCGTCATGGAGCTGGGTCCGT
ACCCGCACAAGTCGCACTCTTGCCCCATCCCGACCTGCGGTCGCCTGTTCAAGCGGTTAGAGCACCTGAAGCGGT
AGGACTTCCCTCACCCTCGCGCCACCGGGTCCGTGTACCGTACACCGTCTGACGCTCAATCTGTCATAGACACGT
GAGGACGCACACGCAAGAGAAGCCCTACATCTGCCCGCACTGCAGCAAAGCCTTTTCCCGATCAGACAATCTGGC
ACAGTACGTGCGCCCCAGGCGGTCCGTTCGCAGAGACAGTCCCGCTAACCTGTTTCCCGCAGACACAAGCGCACG
CACAGTCGCGAGGATGGTGGCGAGAGCTCGATGAACTTGTCGGCTGAAGAGGAGGAGGAGCTGTCTGGTGAGGAC
CACCTCGGTTCTCTCGAGGAGGCGTCGCCGACGTCGGAGGTGGCTTACGTTCCAATGAACACGGCTCCGTCAGAC
GCCGGTTCCAGCAACATGAACGAGAGTCAGAGCTTCAACAGCCTGCAAACACTGAGCATGCCCATGACTATCAGT
CAACCGACCACGATCAACGGCATTATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail