Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2962
Gene name
Locationscaffold_236:16909..17640
Strand+
Gene length (bp)731
Transcript length (bp)666
Coding sequence length (bp)663
Protein length (aa) 221

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01981 PTH2 Peptidyl-tRNA hydrolase PTH2 3.1E-46 102 221

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8R2Y8|PTH2_MOUSE Peptidyl-tRNA hydrolase 2, mitochondrial OS=Mus musculus GN=Ptrh2 PE=1 SV=1 75 220 4.0E-36
sp|Q3ZBL5|PTH2_BOVIN Peptidyl-tRNA hydrolase 2, mitochondrial OS=Bos taurus GN=PTRH2 PE=2 SV=1 88 220 4.0E-34
sp|Q9Y3E5|PTH2_HUMAN Peptidyl-tRNA hydrolase 2, mitochondrial OS=Homo sapiens GN=PTRH2 PE=1 SV=1 90 220 5.0E-34
sp|P34222|PTH2_YEAST Peptidyl-tRNA hydrolase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTH2 PE=1 SV=2 101 220 8.0E-34
sp|Q54ZD0|PTH2_DICDI Probable peptidyl-tRNA hydrolase 2 OS=Dictyostelium discoideum GN=pth2 PE=3 SV=1 99 220 6.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8R2Y8|PTH2_MOUSE Peptidyl-tRNA hydrolase 2, mitochondrial OS=Mus musculus GN=Ptrh2 PE=1 SV=1 75 220 4.0E-36
sp|Q3ZBL5|PTH2_BOVIN Peptidyl-tRNA hydrolase 2, mitochondrial OS=Bos taurus GN=PTRH2 PE=2 SV=1 88 220 4.0E-34
sp|Q9Y3E5|PTH2_HUMAN Peptidyl-tRNA hydrolase 2, mitochondrial OS=Homo sapiens GN=PTRH2 PE=1 SV=1 90 220 5.0E-34
sp|P34222|PTH2_YEAST Peptidyl-tRNA hydrolase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTH2 PE=1 SV=2 101 220 8.0E-34
sp|Q54ZD0|PTH2_DICDI Probable peptidyl-tRNA hydrolase 2 OS=Dictyostelium discoideum GN=pth2 PE=3 SV=1 99 220 6.0E-33
sp|O13830|PTH2_SCHPO Probable peptidyl-tRNA hydrolase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19A8.14 PE=1 SV=1 93 221 1.0E-32
sp|Q877G5|PTH_SULAC Peptidyl-tRNA hydrolase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=pth PE=3 SV=1 103 221 2.0E-30
sp|Q976I0|PTH_SULTO Peptidyl-tRNA hydrolase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pth PE=3 SV=1 103 221 5.0E-30
sp|O97067|PTH2_DROME Probable peptidyl-tRNA hydrolase 2 OS=Drosophila melanogaster GN=CG1307 PE=2 SV=2 98 221 6.0E-30
sp|C3MZS7|PTH_SULIA Peptidyl-tRNA hydrolase OS=Sulfolobus islandicus (strain M.16.27) GN=pth PE=3 SV=1 102 221 6.0E-28
sp|C4KJ09|PTH_SULIK Peptidyl-tRNA hydrolase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=pth PE=3 SV=1 102 221 6.0E-28
sp|C3MJ30|PTH_SULIL Peptidyl-tRNA hydrolase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=pth PE=3 SV=1 102 221 6.0E-28
sp|C3MYS2|PTH_SULIM Peptidyl-tRNA hydrolase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=pth PE=3 SV=1 102 221 6.0E-28
sp|C3NF60|PTH_SULIN Peptidyl-tRNA hydrolase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=pth PE=3 SV=1 102 221 6.0E-28
sp|C3N851|PTH_SULIY Peptidyl-tRNA hydrolase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=pth PE=3 SV=1 102 221 6.0E-28
sp|Q60363|PTH_METJA Peptidyl-tRNA hydrolase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pth PE=1 SV=1 103 221 9.0E-28
sp|Q980V1|PTH_SULSO Peptidyl-tRNA hydrolase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pth PE=1 SV=1 102 221 1.0E-27
sp|Q8U0N0|PTH_PYRFU Peptidyl-tRNA hydrolase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pth PE=3 SV=1 98 221 3.0E-27
sp|A4YD82|PTH_METS5 Peptidyl-tRNA hydrolase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=pth PE=3 SV=1 103 221 6.0E-26
sp|P61414|PTH_HALSA Peptidyl-tRNA hydrolase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pth PE=3 SV=1 102 221 2.0E-25
sp|B0R2Y5|PTH_HALS3 Peptidyl-tRNA hydrolase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=pth PE=3 SV=1 102 221 2.0E-25
sp|Q9V108|PTH_PYRAB Peptidyl-tRNA hydrolase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pth PE=3 SV=2 101 221 4.0E-25
sp|A6USA3|PTH_METVS Peptidyl-tRNA hydrolase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pth PE=3 SV=1 106 221 4.0E-25
sp|B9LTP1|PTH_HALLT Peptidyl-tRNA hydrolase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=pth PE=3 SV=1 102 221 2.0E-24
sp|Q9HLW6|PTH_THEAC Peptidyl-tRNA hydrolase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=pth PE=1 SV=1 103 221 3.0E-24
sp|Q5JDB8|PTH_THEKO Peptidyl-tRNA hydrolase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pth PE=3 SV=1 101 221 6.0E-24
sp|C6A1K8|PTH_THESM Peptidyl-tRNA hydrolase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=pth PE=3 SV=1 103 221 7.0E-24
sp|A9A6B6|PTH_METM6 Peptidyl-tRNA hydrolase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pth PE=3 SV=1 106 221 9.0E-24
sp|B6YTE3|PTH_THEON Peptidyl-tRNA hydrolase OS=Thermococcus onnurineus (strain NA1) GN=pth PE=3 SV=1 103 221 2.0E-23
sp|A4FYL9|PTH_METM5 Peptidyl-tRNA hydrolase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pth PE=3 SV=1 106 221 2.0E-23
sp|A6VJR3|PTH_METM7 Peptidyl-tRNA hydrolase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pth PE=3 SV=1 106 221 4.0E-23
sp|Q97CB4|PTH_THEVO Peptidyl-tRNA hydrolase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=pth PE=3 SV=1 103 221 7.0E-23
sp|Q5V1D3|PTH_HALMA Peptidyl-tRNA hydrolase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=pth PE=3 SV=2 102 221 9.0E-23
sp|P61234|PTH_METMP Peptidyl-tRNA hydrolase OS=Methanococcus maripaludis (strain S2 / LL) GN=pth PE=3 SV=1 106 221 1.0E-22
sp|Q8Q0M4|PTH_METMA Peptidyl-tRNA hydrolase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pth PE=3 SV=2 101 221 2.0E-22
sp|Q9YBD6|PTH_AERPE Peptidyl-tRNA hydrolase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pth PE=3 SV=1 100 221 2.0E-21
sp|A3DMF7|PTH_STAMF Peptidyl-tRNA hydrolase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=pth PE=3 SV=1 99 221 2.0E-21
sp|O27732|PTH_METTH Peptidyl-tRNA hydrolase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pth PE=3 SV=1 103 221 2.0E-21
sp|Q466V4|PTH_METBF Peptidyl-tRNA hydrolase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=pth PE=3 SV=1 101 221 4.0E-21
sp|Q8TV04|PTH_METKA Peptidyl-tRNA hydrolase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pth PE=3 SV=1 103 221 5.0E-21
sp|Q18KN8|PTH_HALWD Peptidyl-tRNA hydrolase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=pth PE=3 SV=1 103 220 2.0E-20
sp|A6UWF5|PTH_META3 Peptidyl-tRNA hydrolase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=pth PE=3 SV=1 103 221 2.0E-20
sp|O74017|PTH_PYRHO Peptidyl-tRNA hydrolase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pth PE=1 SV=1 101 221 2.0E-20
sp|Q12WH8|PTH_METBU Peptidyl-tRNA hydrolase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pth PE=3 SV=1 101 221 2.0E-20
sp|Q8TKX4|PTH_METAC Peptidyl-tRNA hydrolase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pth PE=3 SV=1 101 221 4.0E-20
sp|O28185|PTH_ARCFU Peptidyl-tRNA hydrolase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pth PE=1 SV=1 102 221 4.0E-20
sp|O76387|PTH2_CAEEL Probable peptidyl-tRNA hydrolase 2 OS=Caenorhabditis elegans GN=C24G6.8 PE=3 SV=1 88 221 6.0E-20
sp|A8MBW8|PTH_CALMQ Peptidyl-tRNA hydrolase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=pth PE=3 SV=1 101 221 4.0E-19
sp|P61235|PTH_NANEQ Peptidyl-tRNA hydrolase OS=Nanoarchaeum equitans (strain Kin4-M) GN=pth PE=3 SV=1 103 220 9.0E-19
sp|Q9J5H2|V029_FOWPN Putative peptidyl-tRNA hydrolase OS=Fowlpox virus (strain NVSL) GN=FPV029 PE=3 SV=1 103 219 1.0E-17
sp|Q8ZYM4|PTH_PYRAE Peptidyl-tRNA hydrolase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pth PE=3 SV=1 101 220 6.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0004045 aminoacyl-tRNA hydrolase activity Yes
GO:0016787 hydrolase activity No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0052689 carboxylic ester hydrolase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0140098 catalytic activity, acting on RNA No
GO:0016788 hydrolase activity, acting on ester bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2962
MPAPDQGDQTGVILTTALATFVSGFLFGVFTTRGYLISPALTEERQHNLGDPVESDESDIDEHQSLLDHAPNWAN
SSAADRKQGLRLDKETAAPAAVMDEECKLVLVVRTDLGMTKGKIAAQCSHATLACYKTLARAPPSSPLRQLLTRW
ERNGQAKIALQAKSEEEVRALRRQALDAGLPADVVQDAGRTQIEPGSLTVLGIGPAPKSAVDRITGHLKLL
Coding >Ophio5|2962
ATGCCGGCCCCGGACCAAGGCGACCAAACGGGGGTGATCCTGACGACGGCGCTAGCGACCTTCGTCTCCGGCTTC
CTCTTCGGCGTCTTCACCACCCGCGGCTACCTAATCTCTCCCGCGCTGACGGAAGAGCGACAACACAACCTCGGC
GATCCAGTCGAGAGCGACGAGAGCGACATCGACGAGCATCAGTCTCTACTCGACCATGCGCCTAACTGGGCTAAT
AGCTCCGCTGCCGATCGTAAGCAGGGCTTGCGTCTTGATAAGGAGACGGCGGCGCCTGCTGCTGTGATGGATGAG
GAGTGTAAGCTTGTTCTGGTGGTCAGGACGGATCTGGGCATGACCAAGGGTAAAATCGCCGCCCAATGCTCCCAC
GCGACGCTCGCCTGCTACAAAACCCTCGCCCGCGCACCTCCCTCGTCCCCTCTCCGCCAACTCCTCACCCGCTGG
GAGCGAAACGGCCAAGCCAAGATCGCCCTGCAGGCCAAGAGCGAAGAAGAGGTCCGCGCCCTTCGTCGCCAGGCC
CTCGACGCCGGCCTCCCCGCCGATGTCGTCCAGGACGCAGGTCGTACCCAGATCGAACCCGGGAGCTTGACTGTT
CTTGGTATTGGTCCGGCACCTAAGTCTGCCGTCGATCGCATCACCGGTCATTTGAAGTTGCTC
Transcript >Ophio5|2962
ATGCCGGCCCCGGACCAAGGCGACCAAACGGGGGTGATCCTGACGACGGCGCTAGCGACCTTCGTCTCCGGCTTC
CTCTTCGGCGTCTTCACCACCCGCGGCTACCTAATCTCTCCCGCGCTGACGGAAGAGCGACAACACAACCTCGGC
GATCCAGTCGAGAGCGACGAGAGCGACATCGACGAGCATCAGTCTCTACTCGACCATGCGCCTAACTGGGCTAAT
AGCTCCGCTGCCGATCGTAAGCAGGGCTTGCGTCTTGATAAGGAGACGGCGGCGCCTGCTGCTGTGATGGATGAG
GAGTGTAAGCTTGTTCTGGTGGTCAGGACGGATCTGGGCATGACCAAGGGTAAAATCGCCGCCCAATGCTCCCAC
GCGACGCTCGCCTGCTACAAAACCCTCGCCCGCGCACCTCCCTCGTCCCCTCTCCGCCAACTCCTCACCCGCTGG
GAGCGAAACGGCCAAGCCAAGATCGCCCTGCAGGCCAAGAGCGAAGAAGAGGTCCGCGCCCTTCGTCGCCAGGCC
CTCGACGCCGGCCTCCCCGCCGATGTCGTCCAGGACGCAGGTCGTACCCAGATCGAACCCGGGAGCTTGACTGTT
CTTGGTATTGGTCCGGCACCTAAGTCTGCCGTCGATCGCATCACCGGTCATTTGAAGTTGCTCTAG
Gene >Ophio5|2962
ATGCCGGCCCCGGACCAAGGCGACCAAACGGGGGTGATCCTGACGACGGCGCTAGCGACCTTCGTCTCCGGCTTC
CTCTTCGGCGTCTTCACCACCCGCGGCTACCTAATCTCTCCCGCGCTGACGGAAGAGCGACAACACAACCTCGGC
GATCCAGTCGAGAGCGACGAGAGCGACATCGACGAGCATCAGTCTCTACTCGACCATGCGCCTAACTGGGCTAAT
AGCTCCGCTGCCGATCGTAAGCAGGGCTTGCGTCTTGATAAGGAGACGGCGGCGCCTGCTGCTGTGATGGATGAG
GAGTGTAAGCTTGTTCTGGTGGTCAGGACGGATCTGGGCATGACCAAGGGTATGAAAACCTTTCCATCCGACTCC
TTCCATACCCTACTCACTCAACTCGTCCCGTTCCATCAGGTAAAATCGCCGCCCAATGCTCCCACGCGACGCTCG
CCTGCTACAAAACCCTCGCCCGCGCACCTCCCTCGTCCCCTCTCCGCCAACTCCTCACCCGCTGGGAGCGAAACG
GCCAAGCCAAGATCGCCCTGCAGGCCAAGAGCGAAGAAGAGGTCCGCGCCCTTCGTCGCCAGGCCCTCGACGCCG
GCCTCCCCGCCGATGTCGTCCAGGACGCAGGTCGTACCCAGATCGAACCCGGGAGCTTGACTGTTCTTGGTATTG
GTCCGGCACCTAAGTCTGCCGTCGATCGCATCACCGGTCATTTGAAGTTGCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail