Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2956
Gene name
Locationscaffold_236:4380..5889
Strand+
Gene length (bp)1509
Transcript length (bp)1509
Coding sequence length (bp)1506
Protein length (aa) 502

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6806 0.5615 0.3009 0.1908 0.0913 0.0424 0.1234 0.1128 0.1694 0.0094

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1959
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6944
Ophiocordyceps australis map64 (Brazil) OphauB2|1861
Ophiocordyceps australis map64 (Brazil) OphauB2|4619
Ophiocordyceps australis map64 (Brazil) OphauB2|5847
Ophiocordyceps kimflemingae Ophio5|2956 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2119
Ophiocordyceps subramaniannii Hirsu2|5306

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2956
MASKINFGDPSDKDGRQKLIAYYHVRVKTLDEFKKNAACCLKCKVANQLLTQEQGNYWARVAADIDDWVKDMGKY
ERNETNLSPGSAWTHSLAIQTGQPGVPIVSARVEQVPVEEYCPDLAGDQSSQPQPTSEADQKEGGEELEGVDKEG
SDKPEDEKMSSPESENSQEKSSQEPEAEGKKDSQTPDEKDEEGSQESKTQATESTTKPTAIAETDNKNETAEPKK
DAKETSQQQPQADDQTSSQQIQASIQANLNASIIAIVPQAPSCYLAQAEASTKMQANSAKFRLNTTAEAKVVASQ
FCSPVYYVQRRERGGELETKVVYGQGVAVVGKDRVLVAPEQEKRVWQDCGCDPSAKPVQAQDLGKLVSTTEMLQR
VEEESINIQAHSQHMSFSSFVDISLQLASVPAVGEQVSWTGNSAHLGRTGRASYGVRFGKQEVETEDGVVASAGE
QASSTGTSAQADRTYSTHSEEEQAETMETGINSSSQVSDGSSAEDSDEFCES
Coding >Ophio5|2956
ATGGCTTCCAAGATCAACTTCGGGGACCCTTCTGACAAGGACGGACGCCAGAAGCTCATCGCTTACTACCACGTG
CGGGTCAAGACCTTGGACGAGTTCAAGAAGAATGCTGCGTGCTGCCTCAAGTGCAAGGTAGCTAACCAGCTGCTC
ACGCAGGAGCAGGGGAATTACTGGGCAAGGGTAGCAGCAGACATCGACGATTGGGTCAAGGATATGGGCAAGTAT
GAGAGGAACGAGACCAACCTGTCGCCCGGTAGTGCTTGGACACACTCGCTCGCAATCCAGACCGGTCAGCCGGGA
GTTCCTATTGTGAGCGCGAGGGTCGAGCAGGTGCCAGTTGAGGAGTACTGCCCGGACCTGGCTGGTGATCAGTCG
TCGCAGCCTCAGCCGACTTCCGAGGCCGACCAGAAGGAGGGTGGTGAAGAGCTGGAAGGAGTCGATAAGGAGGGC
AGTGACAAGCCCGAGGATGAGAAGATGAGCAGCCCGGAGTCTGAAAATTCCCAGGAGAAGAGCAGCCAGGAGCCC
GAGGCTGAAGGCAAGAAAGACAGCCAAACTCCTGACGAGAAAGATGAAGAGGGCAGCCAAGAGTCCAAGACTCAA
GCGACGGAAAGCACCACCAAGCCCACAGCCATCGCCGAGACAGACAACAAGAATGAGACGGCGGAGCCCAAGAAA
GACGCAAAGGAGACTAGCCAACAACAGCCCCAAGCAGACGACCAGACGAGCAGCCAGCAAATCCAAGCCTCCATC
CAAGCCAACTTGAACGCGTCCATCATCGCCATCGTCCCGCAGGCGCCGAGCTGTTACCTGGCCCAGGCGGAAGCC
TCGACCAAGATGCAAGCCAACAGTGCCAAATTCAGGCTCAACACCACGGCGGAAGCCAAAGTCGTCGCCTCGCAG
TTCTGCAGCCCCGTCTACTACGTCCAGAGGAGGGAGAGAGGCGGTGAGCTGGAGACCAAGGTCGTTTACGGCCAG
GGTGTTGCCGTCGTCGGCAAGGACCGCGTACTCGTTGCGCCGGAGCAGGAGAAGAGGGTGTGGCAGGATTGCGGT
TGTGATCCGTCGGCTAAGCCCGTCCAGGCGCAGGATTTGGGAAAGCTGGTTTCCACGACGGAGATGCTGCAGCGG
GTCGAGGAGGAGAGCATCAACATCCAAGCTCACTCGCAGCACATGAGCTTCAGCAGCTTCGTTGATATTTCTCTT
CAGTTGGCTTCCGTGCCGGCTGTGGGTGAGCAGGTTTCCTGGACGGGTAACTCGGCTCATTTGGGTCGCACCGGG
AGAGCTTCCTATGGCGTGCGCTTTGGGAAGCAGGAGGTCGAGACCGAGGATGGCGTCGTGGCTTCGGCTGGTGAG
CAGGCCTCGTCGACTGGCACCTCTGCTCAGGCGGACCGGACCTACAGCACGCACTCTGAGGAGGAGCAGGCCGAG
ACCATGGAGACCGGCATCAACTCCTCTTCCCAAGTCAGCGACGGCAGTTCGGCAGAAGATTCTGACGAGTTTTGC
GAGTCG
Transcript >Ophio5|2956
ATGGCTTCCAAGATCAACTTCGGGGACCCTTCTGACAAGGACGGACGCCAGAAGCTCATCGCTTACTACCACGTG
CGGGTCAAGACCTTGGACGAGTTCAAGAAGAATGCTGCGTGCTGCCTCAAGTGCAAGGTAGCTAACCAGCTGCTC
ACGCAGGAGCAGGGGAATTACTGGGCAAGGGTAGCAGCAGACATCGACGATTGGGTCAAGGATATGGGCAAGTAT
GAGAGGAACGAGACCAACCTGTCGCCCGGTAGTGCTTGGACACACTCGCTCGCAATCCAGACCGGTCAGCCGGGA
GTTCCTATTGTGAGCGCGAGGGTCGAGCAGGTGCCAGTTGAGGAGTACTGCCCGGACCTGGCTGGTGATCAGTCG
TCGCAGCCTCAGCCGACTTCCGAGGCCGACCAGAAGGAGGGTGGTGAAGAGCTGGAAGGAGTCGATAAGGAGGGC
AGTGACAAGCCCGAGGATGAGAAGATGAGCAGCCCGGAGTCTGAAAATTCCCAGGAGAAGAGCAGCCAGGAGCCC
GAGGCTGAAGGCAAGAAAGACAGCCAAACTCCTGACGAGAAAGATGAAGAGGGCAGCCAAGAGTCCAAGACTCAA
GCGACGGAAAGCACCACCAAGCCCACAGCCATCGCCGAGACAGACAACAAGAATGAGACGGCGGAGCCCAAGAAA
GACGCAAAGGAGACTAGCCAACAACAGCCCCAAGCAGACGACCAGACGAGCAGCCAGCAAATCCAAGCCTCCATC
CAAGCCAACTTGAACGCGTCCATCATCGCCATCGTCCCGCAGGCGCCGAGCTGTTACCTGGCCCAGGCGGAAGCC
TCGACCAAGATGCAAGCCAACAGTGCCAAATTCAGGCTCAACACCACGGCGGAAGCCAAAGTCGTCGCCTCGCAG
TTCTGCAGCCCCGTCTACTACGTCCAGAGGAGGGAGAGAGGCGGTGAGCTGGAGACCAAGGTCGTTTACGGCCAG
GGTGTTGCCGTCGTCGGCAAGGACCGCGTACTCGTTGCGCCGGAGCAGGAGAAGAGGGTGTGGCAGGATTGCGGT
TGTGATCCGTCGGCTAAGCCCGTCCAGGCGCAGGATTTGGGAAAGCTGGTTTCCACGACGGAGATGCTGCAGCGG
GTCGAGGAGGAGAGCATCAACATCCAAGCTCACTCGCAGCACATGAGCTTCAGCAGCTTCGTTGATATTTCTCTT
CAGTTGGCTTCCGTGCCGGCTGTGGGTGAGCAGGTTTCCTGGACGGGTAACTCGGCTCATTTGGGTCGCACCGGG
AGAGCTTCCTATGGCGTGCGCTTTGGGAAGCAGGAGGTCGAGACCGAGGATGGCGTCGTGGCTTCGGCTGGTGAG
CAGGCCTCGTCGACTGGCACCTCTGCTCAGGCGGACCGGACCTACAGCACGCACTCTGAGGAGGAGCAGGCCGAG
ACCATGGAGACCGGCATCAACTCCTCTTCCCAAGTCAGCGACGGCAGTTCGGCAGAAGATTCTGACGAGTTTTGC
GAGTCGTAG
Gene >Ophio5|2956
ATGGCTTCCAAGATCAACTTCGGGGACCCTTCTGACAAGGACGGACGCCAGAAGCTCATCGCTTACTACCACGTG
CGGGTCAAGACCTTGGACGAGTTCAAGAAGAATGCTGCGTGCTGCCTCAAGTGCAAGGTAGCTAACCAGCTGCTC
ACGCAGGAGCAGGGGAATTACTGGGCAAGGGTAGCAGCAGACATCGACGATTGGGTCAAGGATATGGGCAAGTAT
GAGAGGAACGAGACCAACCTGTCGCCCGGTAGTGCTTGGACACACTCGCTCGCAATCCAGACCGGTCAGCCGGGA
GTTCCTATTGTGAGCGCGAGGGTCGAGCAGGTGCCAGTTGAGGAGTACTGCCCGGACCTGGCTGGTGATCAGTCG
TCGCAGCCTCAGCCGACTTCCGAGGCCGACCAGAAGGAGGGTGGTGAAGAGCTGGAAGGAGTCGATAAGGAGGGC
AGTGACAAGCCCGAGGATGAGAAGATGAGCAGCCCGGAGTCTGAAAATTCCCAGGAGAAGAGCAGCCAGGAGCCC
GAGGCTGAAGGCAAGAAAGACAGCCAAACTCCTGACGAGAAAGATGAAGAGGGCAGCCAAGAGTCCAAGACTCAA
GCGACGGAAAGCACCACCAAGCCCACAGCCATCGCCGAGACAGACAACAAGAATGAGACGGCGGAGCCCAAGAAA
GACGCAAAGGAGACTAGCCAACAACAGCCCCAAGCAGACGACCAGACGAGCAGCCAGCAAATCCAAGCCTCCATC
CAAGCCAACTTGAACGCGTCCATCATCGCCATCGTCCCGCAGGCGCCGAGCTGTTACCTGGCCCAGGCGGAAGCC
TCGACCAAGATGCAAGCCAACAGTGCCAAATTCAGGCTCAACACCACGGCGGAAGCCAAAGTCGTCGCCTCGCAG
TTCTGCAGCCCCGTCTACTACGTCCAGAGGAGGGAGAGAGGCGGTGAGCTGGAGACCAAGGTCGTTTACGGCCAG
GGTGTTGCCGTCGTCGGCAAGGACCGCGTACTCGTTGCGCCGGAGCAGGAGAAGAGGGTGTGGCAGGATTGCGGT
TGTGATCCGTCGGCTAAGCCCGTCCAGGCGCAGGATTTGGGAAAGCTGGTTTCCACGACGGAGATGCTGCAGCGG
GTCGAGGAGGAGAGCATCAACATCCAAGCTCACTCGCAGCACATGAGCTTCAGCAGCTTCGTTGATATTTCTCTT
CAGTTGGCTTCCGTGCCGGCTGTGGGTGAGCAGGTTTCCTGGACGGGTAACTCGGCTCATTTGGGTCGCACCGGG
AGAGCTTCCTATGGCGTGCGCTTTGGGAAGCAGGAGGTCGAGACCGAGGATGGCGTCGTGGCTTCGGCTGGTGAG
CAGGCCTCGTCGACTGGCACCTCTGCTCAGGCGGACCGGACCTACAGCACGCACTCTGAGGAGGAGCAGGCCGAG
ACCATGGAGACCGGCATCAACTCCTCTTCCCAAGTCAGCGACGGCAGTTCGGCAGAAGATTCTGACGAGTTTTGC
GAGTCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail