Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2953
Gene name
Locationscaffold_235:19985..23923
Strand-
Gene length (bp)3938
Transcript length (bp)3597
Coding sequence length (bp)3594
Protein length (aa) 1198

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01544 CorA CorA-like Mg2+ transporter protein 1.3E-11 1014 1135
PF05057 DUF676 Putative serine esterase (DUF676) 1.4E-04 143 212

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5SNQ7|SRAC1_DANRE Protein SERAC1 OS=Danio rerio GN=serac1 PE=3 SV=1 130 238 3.0E-08
sp|Q96JX3|SRAC1_HUMAN Protein SERAC1 OS=Homo sapiens GN=SERAC1 PE=1 SV=1 15 190 4.0E-07
sp|Q2TBM9|SRAC1_BOVIN Protein SERAC1 OS=Bos taurus GN=SERAC1 PE=2 SV=1 92 190 9.0E-07
sp|Q3U213|SRAC1_MOUSE Protein SERAC1 OS=Mus musculus GN=Serac1 PE=2 SV=1 17 190 2.0E-06

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0030001 metal ion transport Yes
GO:0055085 transmembrane transport Yes
GO:0015075 ion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0008324 cation transmembrane transporter activity No
GO:0006811 ion transport No
GO:0006812 cation transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

Domain # Start End Length
1 1081 1103 22
2 1116 1138 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 29.44 15.97 42.91
CcL In ants, during behavior modification 12.88 6.61 19.15
CcD In ants, recently dead 13.35 6.93 19.77

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.906154 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2953
MTVAPLSESESGENEAKKSHYSSDSSARFVVDPAGERTYDETTVDVVTVPCPGADPLQSWSRDGLVGRYFGAPSM
RDAEAVPARHGAASGPSWVRQGIRREAPRARILLYAHPEMMAGTTLADLADSLLEELRVLRVGEAAERPLVFIAH
SIGGLVVKMALTKAARDARYESVLRECYGVAFFGTPHQGSSYFAMHGLADSIQSLLRLSAPLPASITDSLRVGND
LLLRVDDDFKAVSHDVRIWTLYETIESRFAAPEPRSDDVYFTAPITSSKSAILGMRQESIFALQSDHANMASFGR
HNGRVLHLFLRQLAVLIARADMALLHAADDAVARWSLDLERKVSVEVHGFFDDAPAADVSTIRAWSTRLPLSDFL
AKGPVTCLSERLNEVDDADANTAPDEGLQSTPERLEPPLMMVRNALGIRASQPASPVSPHLRPSDVERRPNPPSP
RDASPATVRSSSPTRPSSLVRADLEQDLAVDRLSPPLRPRIGRAISRSFSDGFSRLEYREFLAMSPRSRSAVDDV
IAGAHDDVDDIEASPKLPEAVVAIRNIVNMAGVRSRAFGSTMAKEPAPAFAKPDVKARRFVWVHVPFNNPTWVKS
VLQTLEVSYGRNLSALYGHDFWATRHTRGRHPQHYAYFAKPGCYVPSPRTLSSGSRTAAAANEAAYMCLFLPYLH
FDSYRRLIRRRNLIRQRLHHGRARPVPESVAKSDLLELQVVWEFLGHDPPVNCRRTLDQFGHPSLRDTRSRDDDQ
MLYKLTKDRGLGAVPGPAADVRSQGSSAGTAGAASDRAGSGASTTSGGWRERLLRRGGTETADDAPEEETVLDGK
VLMVDQLWLWAIDSHTLVSFFPRRESDPIEGPLYQQADLRDSIFNDVNVDLTRQCKNALDLAALAALHAVSVLLD
RSSHPDLEVFRIFDEAISALTEKLTWTLKAFRAGGFRDKAVQDDDDPVENIRARHRQEALQAELENRDSTSALLE
LRDIEDELLMLCQLFDQQSKVLSAMQGAYLRPERREHTANGRVFLSEALRRLRDDAQRAGDMVQRVRSTRDDYDK
LLQMVQRQAQVDEVRLSRLHADLAGAQSRSVTIFTTFTVIFLPLTFFTGLFGMNTRQWGGGGNLPLETIASVALP
SSFVLVAVALVIAYSSSARTLPRRAVGRLLGCMLRATRSADDGVPAGGEPARRRRVPDREGVSYPRGESEGGG
Coding >Ophio5|2953
ATGACCGTCGCGCCGCTGTCCGAGTCCGAGAGTGGCGAGAACGAGGCCAAGAAGAGCCATTACAGCTCTGACTCG
TCTGCCCGCTTCGTCGTCGATCCCGCTGGTGAGCGCACCTACGATGAAACGACCGTCGACGTCGTCACGGTGCCG
TGTCCCGGCGCCGATCCTCTTCAGAGCTGGAGTCGGGATGGGTTGGTGGGACGATACTTCGGCGCACCATCGATG
CGTGATGCCGAGGCCGTTCCGGCCCGTCACGGAGCTGCCTCCGGTCCGTCGTGGGTGCGGCAGGGCATCCGTCGG
GAGGCTCCCCGTGCGCGCATCCTGCTGTATGCGCATCCGGAGATGATGGCTGGCACCACTCTGGCCGACCTTGCC
GACTCCCTACTCGAGGAGCTGCGTGTGCTGAGGGTCGGTGAGGCGGCGGAGCGGCCACTCGTCTTCATCGCCCAT
AGCATCGGCGGTCTGGTCGTCAAGATGGCACTAACCAAGGCAGCGCGCGATGCCCGGTACGAGAGCGTGCTGCGC
GAGTGCTATGGCGTTGCCTTTTTCGGCACTCCTCATCAAGGCTCCAGCTACTTCGCCATGCACGGCCTTGCCGAC
AGCATCCAGAGCCTGCTCCGACTTTCGGCACCGCTGCCGGCTTCCATCACGGACAGCCTCCGTGTCGGAAACGAC
CTGCTACTGCGTGTCGACGACGACTTCAAGGCTGTTTCCCACGATGTGCGTATCTGGACACTCTACGAGACTATT
GAATCGCGCTTCGCCGCCCCCGAGCCTCGTTCCGACGACGTCTACTTCACCGCGCCCATCACCTCCAGCAAATCG
GCCATTCTCGGCATGCGCCAGGAGTCCATCTTCGCCCTTCAGAGCGATCACGCCAACATGGCCTCCTTTGGTCGC
CACAACGGCCGCGTCTTGCACCTTTTCCTGCGCCAGCTGGCTGTTCTCATCGCCCGCGCCGACATGGCCCTGCTC
CATGCCGCCGATGATGCTGTTGCTCGCTGGTCTCTCGATCTCGAGCGCAAGGTCAGCGTCGAGGTTCACGGCTTC
TTTGATGACGCGCCCGCTGCCGATGTCTCTACTATTCGAGCTTGGTCTACCCGCCTACCGCTCAGCGACTTTCTC
GCCAAGGGCCCTGTAACGTGCCTGAGCGAGCGCCTGAACGAGGTCGACGACGCTGACGCCAACACCGCCCCTGAT
GAGGGCCTTCAGTCTACCCCTGAGCGCCTGGAGCCGCCTCTGATGATGGTCCGGAACGCGCTGGGCATCCGAGCC
AGTCAGCCGGCTTCACCAGTGTCTCCTCATCTCCGTCCGTCTGACGTCGAACGTCGCCCCAACCCGCCGTCGCCC
CGAGACGCCTCACCCGCGACGGTGAGGTCAAGTTCGCCGACGCGTCCGTCGTCGTTGGTCCGGGCCGACCTGGAG
CAGGATCTGGCCGTCGATCGGCTCTCGCCCCCTTTGCGTCCGCGCATTGGCCGGGCCATTAGCCGGTCTTTCAGC
GACGGATTCTCGCGTCTCGAGTACCGTGAGTTTCTTGCCATGTCACCGCGCAGCCGCAGCGCCGTCGACGACGTC
ATTGCTGGCGCCCATGACGATGTCGACGATATCGAAGCGTCTCCCAAATTGCCGGAGGCTGTCGTTGCAATACGC
AATATCGTCAACATGGCAGGCGTCAGGAGCCGGGCTTTCGGATCGACCATGGCCAAGGAGCCGGCGCCGGCGTTT
GCAAAGCCGGATGTCAAAGCTCGGAGGTTTGTCTGGGTACATGTGCCTTTTAACAACCCGACCTGGGTCAAGAGC
GTGCTTCAGACACTCGAGGTGTCGTACGGCAGGAATCTTTCGGCGCTTTATGGCCACGACTTCTGGGCTACCAGA
CACACGCGAGGGAGACATCCTCAGCATTATGCCTACTTTGCAAAGCCTGGCTGTTACGTTCCCTCACCGCGAACA
CTCTCGTCAGGTTCGCGGACCGCCGCTGCAGCCAACGAAGCCGCCTACATGTGCCTTTTCCTGCCCTACCTGCAC
TTCGACTCGTACAGGCGGCTCATCAGGCGGCGAAACCTGATCCGGCAGCGGCTGCATCACGGACGGGCCCGGCCG
GTGCCTGAGTCGGTGGCCAAGTCGGATCTGCTGGAGCTCCAGGTGGTCTGGGAGTTTCTCGGCCACGACCCGCCG
GTCAACTGTCGCCGGACGTTGGATCAGTTTGGCCACCCGTCGCTGCGGGACACACGGTCTCGCGACGACGACCAA
ATGCTGTATAAGCTGACCAAAGACCGCGGCCTCGGCGCCGTGCCGGGGCCAGCTGCCGACGTCCGCAGCCAGGGC
TCCAGCGCGGGCACGGCGGGCGCCGCCTCGGACCGGGCCGGAAGCGGAGCCAGTACCACGTCCGGCGGCTGGCGC
GAACGACTTCTGCGCCGGGGCGGGACGGAGACGGCGGACGATGCGCCTGAGGAGGAGACGGTGCTGGACGGCAAG
GTGCTCATGGTCGACCAGCTCTGGCTCTGGGCCATTGACTCGCATACCCTGGTCTCGTTCTTCCCCAGGCGCGAG
AGCGATCCGATCGAGGGGCCGCTGTACCAGCAAGCAGACCTTCGGGACAGCATCTTCAACGACGTCAACGTCGAC
CTCACGCGACAGTGCAAGAACGCTCTTGATCTGGCGGCGCTGGCGGCGCTTCATGCCGTGAGCGTGCTTTTGGAT
CGGTCGTCGCACCCCGACCTCGAGGTGTTTCGCATCTTTGACGAGGCCATCAGTGCCCTGACGGAGAAGCTCACG
TGGACGCTCAAGGCGTTTCGCGCGGGGGGCTTCCGCGACAAGGCCGTCCAAGACGACGACGATCCTGTCGAGAAT
ATCAGGGCTCGCCACCGCCAGGAAGCGCTCCAGGCGGAGCTGGAGAACCGCGACAGCACCTCTGCGCTTCTGGAG
CTGCGCGACATCGAGGATGAGCTGCTAATGCTCTGCCAACTCTTCGACCAGCAGTCCAAGGTGCTCTCCGCCATG
CAAGGCGCCTACCTCCGGCCCGAGCGCCGCGAACACACGGCCAACGGCCGCGTCTTTTTGTCCGAGGCCCTGCGT
CGGCTGCGCGATGATGCCCAACGGGCGGGAGATATGGTGCAGCGGGTGCGAAGCACGCGAGACGACTACGATAAG
TTGCTACAGATGGTGCAGCGTCAGGCGCAGGTCGACGAGGTGAGGCTCAGCAGGCTTCACGCCGATCTCGCCGGT
GCGCAGAGTCGAAGCGTCACCATCTTCACCACTTTCACCGTCATCTTCCTACCCCTGACCTTCTTCACCGGCCTG
TTCGGCATGAACACGCGCCAATGGGGTGGTGGCGGCAATCTCCCACTGGAAACGATTGCCAGCGTCGCCCTGCCG
TCCAGCTTCGTCCTCGTCGCCGTCGCGCTTGTCATCGCCTACAGCTCCTCTGCCCGAACGCTGCCCCGTCGGGCC
GTGGGCCGTCTCCTCGGCTGCATGCTCCGGGCGACGCGTTCGGCAGACGACGGGGTGCCGGCGGGCGGAGAGCCG
GCCAGGCGGAGGCGCGTGCCCGACAGAGAGGGGGTATCGTATCCCCGAGGTGAATCGGAAGGTGGCGGC
Transcript >Ophio5|2953
ATGACCGTCGCGCCGCTGTCCGAGTCCGAGAGTGGCGAGAACGAGGCCAAGAAGAGCCATTACAGCTCTGACTCG
TCTGCCCGCTTCGTCGTCGATCCCGCTGGTGAGCGCACCTACGATGAAACGACCGTCGACGTCGTCACGGTGCCG
TGTCCCGGCGCCGATCCTCTTCAGAGCTGGAGTCGGGATGGGTTGGTGGGACGATACTTCGGCGCACCATCGATG
CGTGATGCCGAGGCCGTTCCGGCCCGTCACGGAGCTGCCTCCGGTCCGTCGTGGGTGCGGCAGGGCATCCGTCGG
GAGGCTCCCCGTGCGCGCATCCTGCTGTATGCGCATCCGGAGATGATGGCTGGCACCACTCTGGCCGACCTTGCC
GACTCCCTACTCGAGGAGCTGCGTGTGCTGAGGGTCGGTGAGGCGGCGGAGCGGCCACTCGTCTTCATCGCCCAT
AGCATCGGCGGTCTGGTCGTCAAGATGGCACTAACCAAGGCAGCGCGCGATGCCCGGTACGAGAGCGTGCTGCGC
GAGTGCTATGGCGTTGCCTTTTTCGGCACTCCTCATCAAGGCTCCAGCTACTTCGCCATGCACGGCCTTGCCGAC
AGCATCCAGAGCCTGCTCCGACTTTCGGCACCGCTGCCGGCTTCCATCACGGACAGCCTCCGTGTCGGAAACGAC
CTGCTACTGCGTGTCGACGACGACTTCAAGGCTGTTTCCCACGATGTGCGTATCTGGACACTCTACGAGACTATT
GAATCGCGCTTCGCCGCCCCCGAGCCTCGTTCCGACGACGTCTACTTCACCGCGCCCATCACCTCCAGCAAATCG
GCCATTCTCGGCATGCGCCAGGAGTCCATCTTCGCCCTTCAGAGCGATCACGCCAACATGGCCTCCTTTGGTCGC
CACAACGGCCGCGTCTTGCACCTTTTCCTGCGCCAGCTGGCTGTTCTCATCGCCCGCGCCGACATGGCCCTGCTC
CATGCCGCCGATGATGCTGTTGCTCGCTGGTCTCTCGATCTCGAGCGCAAGGTCAGCGTCGAGGTTCACGGCTTC
TTTGATGACGCGCCCGCTGCCGATGTCTCTACTATTCGAGCTTGGTCTACCCGCCTACCGCTCAGCGACTTTCTC
GCCAAGGGCCCTGTAACGTGCCTGAGCGAGCGCCTGAACGAGGTCGACGACGCTGACGCCAACACCGCCCCTGAT
GAGGGCCTTCAGTCTACCCCTGAGCGCCTGGAGCCGCCTCTGATGATGGTCCGGAACGCGCTGGGCATCCGAGCC
AGTCAGCCGGCTTCACCAGTGTCTCCTCATCTCCGTCCGTCTGACGTCGAACGTCGCCCCAACCCGCCGTCGCCC
CGAGACGCCTCACCCGCGACGGTGAGGTCAAGTTCGCCGACGCGTCCGTCGTCGTTGGTCCGGGCCGACCTGGAG
CAGGATCTGGCCGTCGATCGGCTCTCGCCCCCTTTGCGTCCGCGCATTGGCCGGGCCATTAGCCGGTCTTTCAGC
GACGGATTCTCGCGTCTCGAGTACCGTGAGTTTCTTGCCATGTCACCGCGCAGCCGCAGCGCCGTCGACGACGTC
ATTGCTGGCGCCCATGACGATGTCGACGATATCGAAGCGTCTCCCAAATTGCCGGAGGCTGTCGTTGCAATACGC
AATATCGTCAACATGGCAGGCGTCAGGAGCCGGGCTTTCGGATCGACCATGGCCAAGGAGCCGGCGCCGGCGTTT
GCAAAGCCGGATGTCAAAGCTCGGAGGTTTGTCTGGGTACATGTGCCTTTTAACAACCCGACCTGGGTCAAGAGC
GTGCTTCAGACACTCGAGGTGTCGTACGGCAGGAATCTTTCGGCGCTTTATGGCCACGACTTCTGGGCTACCAGA
CACACGCGAGGGAGACATCCTCAGCATTATGCCTACTTTGCAAAGCCTGGCTGTTACGTTCCCTCACCGCGAACA
CTCTCGTCAGGTTCGCGGACCGCCGCTGCAGCCAACGAAGCCGCCTACATGTGCCTTTTCCTGCCCTACCTGCAC
TTCGACTCGTACAGGCGGCTCATCAGGCGGCGAAACCTGATCCGGCAGCGGCTGCATCACGGACGGGCCCGGCCG
GTGCCTGAGTCGGTGGCCAAGTCGGATCTGCTGGAGCTCCAGGTGGTCTGGGAGTTTCTCGGCCACGACCCGCCG
GTCAACTGTCGCCGGACGTTGGATCAGTTTGGCCACCCGTCGCTGCGGGACACACGGTCTCGCGACGACGACCAA
ATGCTGTATAAGCTGACCAAAGACCGCGGCCTCGGCGCCGTGCCGGGGCCAGCTGCCGACGTCCGCAGCCAGGGC
TCCAGCGCGGGCACGGCGGGCGCCGCCTCGGACCGGGCCGGAAGCGGAGCCAGTACCACGTCCGGCGGCTGGCGC
GAACGACTTCTGCGCCGGGGCGGGACGGAGACGGCGGACGATGCGCCTGAGGAGGAGACGGTGCTGGACGGCAAG
GTGCTCATGGTCGACCAGCTCTGGCTCTGGGCCATTGACTCGCATACCCTGGTCTCGTTCTTCCCCAGGCGCGAG
AGCGATCCGATCGAGGGGCCGCTGTACCAGCAAGCAGACCTTCGGGACAGCATCTTCAACGACGTCAACGTCGAC
CTCACGCGACAGTGCAAGAACGCTCTTGATCTGGCGGCGCTGGCGGCGCTTCATGCCGTGAGCGTGCTTTTGGAT
CGGTCGTCGCACCCCGACCTCGAGGTGTTTCGCATCTTTGACGAGGCCATCAGTGCCCTGACGGAGAAGCTCACG
TGGACGCTCAAGGCGTTTCGCGCGGGGGGCTTCCGCGACAAGGCCGTCCAAGACGACGACGATCCTGTCGAGAAT
ATCAGGGCTCGCCACCGCCAGGAAGCGCTCCAGGCGGAGCTGGAGAACCGCGACAGCACCTCTGCGCTTCTGGAG
CTGCGCGACATCGAGGATGAGCTGCTAATGCTCTGCCAACTCTTCGACCAGCAGTCCAAGGTGCTCTCCGCCATG
CAAGGCGCCTACCTCCGGCCCGAGCGCCGCGAACACACGGCCAACGGCCGCGTCTTTTTGTCCGAGGCCCTGCGT
CGGCTGCGCGATGATGCCCAACGGGCGGGAGATATGGTGCAGCGGGTGCGAAGCACGCGAGACGACTACGATAAG
TTGCTACAGATGGTGCAGCGTCAGGCGCAGGTCGACGAGGTGAGGCTCAGCAGGCTTCACGCCGATCTCGCCGGT
GCGCAGAGTCGAAGCGTCACCATCTTCACCACTTTCACCGTCATCTTCCTACCCCTGACCTTCTTCACCGGCCTG
TTCGGCATGAACACGCGCCAATGGGGTGGTGGCGGCAATCTCCCACTGGAAACGATTGCCAGCGTCGCCCTGCCG
TCCAGCTTCGTCCTCGTCGCCGTCGCGCTTGTCATCGCCTACAGCTCCTCTGCCCGAACGCTGCCCCGTCGGGCC
GTGGGCCGTCTCCTCGGCTGCATGCTCCGGGCGACGCGTTCGGCAGACGACGGGGTGCCGGCGGGCGGAGAGCCG
GCCAGGCGGAGGCGCGTGCCCGACAGAGAGGGGGTATCGTATCCCCGAGGTGAATCGGAAGGTGGCGGCTAG
Gene >Ophio5|2953
ATGACCGTCGCGCCGCTGTCCGAGTCCGAGAGTGGCGAGAACGAGGCCAAGAAGAGCCATTACAGCTCTGACTCG
TCTGCCCGCTTCGTCGTCGATCCCGCTGGTGAGCGCACCTACGATGAAACGACCGTCGACGTCGTCACGGTGCCG
TGTCCCGGCGCCGATCCTCTTCAGAGCTGGAGTCGGGATGGGTTGGTGGGACGATACTTCGGCGCACCATCGATG
CGTGATGCCGAGGCCGTTCCGGCCCGTCACGGAGCTGCCTCCGGTCCGTCGTGGGTGCGGCAGGGCATCCGTCGG
GAGGCTCCCCGTGCGCGCATCCTGCTGTATGCGCATCCGGAGATGATGGCTGGCACCACTCTGGCCGACCTTGCC
GACTCCCTACTCGAGGAGCTGCGTGTGCTGAGGGTCGGTGAGGCGGCGGAGCGGCCACTCGTCTTCATCGCCCAT
AGCATCGGCGGTCTGGTCGTCAAGATGGCACTAACCAAGGCAGCGCGCGATGCCCGGTACGAGAGCGTGCTGCGC
GAGTGCTATGGCGTTGCCTTTTTCGGTGAGAATCTCTTGGTCCTGGCATCAATCCCCTTACAAGTCCCTAACACA
CCTACTTCTCAGGCACTCCTCATCAAGGCTCCAGCTACTTCGCCATGCACGGCCTTGCCGACAGCATCCAGAGCC
TGCTCCGACTTTCGGCACCGCTGCCGGCTTCCATCACGGACAGCCTCCGTGTCGGAAACGACCTGCTACTGCGTG
TCGACGACGACTTCAAGGCTGTTTCCCACGATGTGCGTATCTGGACACTCTACGAGACTATTGAATCGCGCTTCG
CCGCCCCCGAGCCTCGTTCCGACGACGTCTACTTCACCGCGCCCATCACCTCCAGCAAATCGGCCATTCTCGGCA
TGCGCCAGGAGTCCATCTTCGCCCTTCAGAGCGATCACGCCAACATGGCCTCCTTTGGTCGCCACAACGGCCGCG
TCTTGCACCTTTTCCTGCGCCAGCTGGCTGTTCTCATCGCCCGCGCCGACATGGCCCTGCTCCATGCCGCCGATG
ATGCTGTTGCTCGCTGGTCTCTCGATCTCGAGCGCAAGGTCAGCGTCGAGGTTCACGGCTTCTTTGATGACGCGC
CCGCTGCCGATGTCTCTACTATTCGAGCTTGGTCTACCCGCCTACCGCTCAGCGACTTTCTCGCCAAGGGCCCTG
TAACGTGCCTGAGCGAGCGCCTGAACGAGGTCGACGACGCTGACGCCAACACCGCCCCTGATGAGGGCCTTCAGT
CTACCCCTGAGCGCCTGGAGCCGCCTCTGATGATGGTCCGGAACGCGCTGGGCATCCGAGCCAGTCAGCCGGCTT
CACCAGTGTCTCCTCATCTCCGTCCGTCTGACGTCGAACGTCGCCCCAACCCGCCGTCGCCCCGAGACGCCTCAC
CCGCGACGGTGAGGTCAAGTTCGCCGACGCGTCCGTCGTCGTTGGTCCGGGCCGACCTGGAGCAGGATCTGGCCG
TCGATCGGCTCTCGCCCCCTTTGCGTCCGCGCATTGGCCGGGCCATTAGCCGGTCTTTCAGCGACGGATTCTCGC
GTCTCGAGTACCGTGAGTTTCTTGCCATGTCACCGCGCAGCCGCAGCGCCGTCGACGACGTCATTGCTGGCGCCC
ATGACGATGTCGACGATATCGAAGCGTCTCCCAAATTGCCGGAGGCTGTCGTTGCAATACGCAATATCGTCAACA
TGGCAGGCGTCAGGAGCCGGGCTTTCGGATCGACCATGGCCAAGGAGCCGGCGCCGGCGTTTGCAAAGCCGGATG
TCAAAGCTCGGAGGTTTGTCTGGGTACATGTGCCTTTTAACAACCCGACCTGGGTCAAGGTGAGAGAGCGGCCGT
AACACTTTGCGGGGGACCAAGGAGGTGCAGAGCTGATACGAATGACGGCCAGAGCGTGCTTCAGACACTCGAGGT
GTCGTACGGCAGGAATCTTTCGGCGCTTTATGGCCACGACTTCTGGGCTACCAGACACACGCGAGGGAGACATCC
TCAGCATTATGCCTACTTTGCAAAGCCTGGCTGTTACGTTCCCTCACCGCGAACACGCAAGTCTTTATTTCCCAG
CCGGCTCGAGAATCAAGGTGCTGACAGCAGCAGTCTCGTCAGGTTCGCGGACCGCCGCTGCAGCCAACGAAGCCG
CCTACATGTGCCTTTTCCTGCCCTACCTGCACTTCGACTCGTACAGGCGGCTCATCAGGCGGCGAAACCTGATCC
GGCAGCGGCTGCATCACGGACGGGCCCGGCCGGTGCCTGAGTCGGTGGCCAAGTCGGATCTGCTGGAGCTCCAGG
TGGTCTGGGAGTTTCTCGGCCACGACCCGCCGGTCAACTGTCGCCGGACGTTGGATCAGTTTGGCCACCCGTCGC
TGCGGGACACACGGTCTCGCGACGACGACCAAATGCTGTATAAGCTGACCAAAGACCGCGGCCTCGGCGCCGTGC
CGGGGCCAGCTGCCGACGTCCGCAGCCAGGGCTCCAGCGCGGGCACGGCGGGCGCCGCCTCGGACCGGGCCGGAA
GCGGAGCCAGTACCACGTCCGGCGGCTGGCGCGAACGACTTCTGCGCCGGGGCGGGACGGAGACGGCGGACGATG
CGCCTGAGGAGGAGACGGTGCTGGACGGCAAGGTGCTCATGGTCGACCAGCTCTGGCTCTGGGCCATTGACTCGC
GTACGTGAATGCCGACTCACAATCAAAAGGCTCAAACTGCCATCTAACGTCGCAGAAACAGATACCCTGGTCTCG
TTCTTCCCCAGGCGCGAGAGCGATCCGATCGAGGGGCCGCTGTACCAGCAAGCAGACCTTCGGGACAGCATCTTC
AACGACGTCAACGTCGACCTCACGCGACAGTGCAAGAACGCTCTTGATCTGGCGGCGCTGGCGGCGCTTCATGCC
GTGAGCGTGCTTTTGGATCGGTCGTCGCACCCCGACCTCGAGGTGTTTCGCATCTTTGACGAGGCCATCAGTGCC
CTGGTCCGTACTGCTCCTGGTTCTCTCCCAAATGCTACGGCTGACGACAGGGACACATAGACGGAGAAGCTCACG
TGGACGCTCAAGGCGTTTCGCGCGGGGGGCTTCCGCGACAAGGCCGTCCAAGACGACGACGATCCTGTCGAGAAT
ATCAGGGCTCGCCACCGCCAGGAAGCGCTCCAGGCGGAGCTGGAGAACCGCGACAGCACCTCTGCGCTTCTGGAG
CTGCGCGACATCGAGGATGAGCTGCTAATGCTCTGCCAACTCTTCGACCAGCAGTCCAAGGTGCTCTCCGCCATG
CAAGGCGCCTACCTCCGGCCCGAGCGCCGCGAACACACGGCCAACGGCCGCGTCTTTTTGTCCGAGGCCCTGCGT
CGGCTGCGCGATGATGCCCAACGGGCGGGAGATATGGTGCAGCGGGTGCGAAGCACGCGAGACGACTACGATAAG
TTGCTACAGATGGTGCAGCGTCAGGCGCAGGTCGACGAGGTGAGGCTCAGCAGGCTTCACGCCGATCTCGCCGGT
GCGCAGAGTCGAAGCGTCACCATCTTCACCACTTTCACCGTCATCTTCCTACCCCTGACCTTCTTCACCGGCCTG
TTCGGCATGAACACGCGCCAATGGGGTGGTGGCGGCAATCTCCCACTGGAAACGATTGCCAGCGTCGCCCTGCCG
TCCAGCTTCGTCCTCGTCGCCGTCGCGCTTGTCATCGCCTACAGCTCCTCTGCCCGAACGCTGCCCCGTCGGGCC
GTGGGCCGTCTCCTCGGCTGCATGCTCCGGGCGACGCGTTCGGCAGACGACGGGGTGCCGGCGGGCGGAGAGCCG
GCCAGGCGGAGGCGCGTGCCCGACAGAGAGGTTAGTGACTTTTGGGACAGGCATCGACTTGAGCGTGATAGGGGG
TATCGTATCCCCGAGGTGAATCGGAAGGTGGCGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail