Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2953
Gene name
Locationscaffold_235:19985..23923
Strand-
Gene length (bp)3938
Transcript length (bp)3597
Coding sequence length (bp)3594
Protein length (aa) 1198

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01544 CorA CorA-like Mg2+ transporter protein 1.3E-11 1014 1135
PF05057 DUF676 Putative serine esterase (DUF676) 1.4E-04 143 212

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5SNQ7|SRAC1_DANRE Protein SERAC1 OS=Danio rerio GN=serac1 PE=3 SV=1 130 238 3.0E-08
sp|Q96JX3|SRAC1_HUMAN Protein SERAC1 OS=Homo sapiens GN=SERAC1 PE=1 SV=1 15 190 4.0E-07
sp|Q2TBM9|SRAC1_BOVIN Protein SERAC1 OS=Bos taurus GN=SERAC1 PE=2 SV=1 92 190 9.0E-07
sp|Q3U213|SRAC1_MOUSE Protein SERAC1 OS=Mus musculus GN=Serac1 PE=2 SV=1 17 190 2.0E-06

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0030001 metal ion transport Yes
GO:0055085 transmembrane transport Yes
GO:0015075 ion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0008324 cation transmembrane transporter activity No
GO:0006811 ion transport No
GO:0006812 cation transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

Domain # Start End Length
1 1081 1103 22
2 1116 1138 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2953
MTVAPLSESESGENEAKKSHYSSDSSARFVVDPAGERTYDETTVDVVTVPCPGADPLQSWSRDGLVGRYFGAPSM
RDAEAVPARHGAASGPSWVRQGIRREAPRARILLYAHPEMMAGTTLADLADSLLEELRVLRVGEAAERPLVFIAH
SIGGLVVKMALTKAARDARYESVLRECYGVAFFGTPHQGSSYFAMHGLADSIQSLLRLSAPLPASITDSLRVGND
LLLRVDDDFKAVSHDVRIWTLYETIESRFAAPEPRSDDVYFTAPITSSKSAILGMRQESIFALQSDHANMASFGR
HNGRVLHLFLRQLAVLIARADMALLHAADDAVARWSLDLERKVSVEVHGFFDDAPAADVSTIRAWSTRLPLSDFL
AKGPVTCLSERLNEVDDADANTAPDEGLQSTPERLEPPLMMVRNALGIRASQPASPVSPHLRPSDVERRPNPPSP
RDASPATVRSSSPTRPSSLVRADLEQDLAVDRLSPPLRPRIGRAISRSFSDGFSRLEYREFLAMSPRSRSAVDDV
IAGAHDDVDDIEASPKLPEAVVAIRNIVNMAGVRSRAFGSTMAKEPAPAFAKPDVKARRFVWVHVPFNNPTWVKS
VLQTLEVSYGRNLSALYGHDFWATRHTRGRHPQHYAYFAKPGCYVPSPRTLSSGSRTAAAANEAAYMCLFLPYLH
FDSYRRLIRRRNLIRQRLHHGRARPVPESVAKSDLLELQVVWEFLGHDPPVNCRRTLDQFGHPSLRDTRSRDDDQ
MLYKLTKDRGLGAVPGPAADVRSQGSSAGTAGAASDRAGSGASTTSGGWRERLLRRGGTETADDAPEEETVLDGK
VLMVDQLWLWAIDSHTLVSFFPRRESDPIEGPLYQQADLRDSIFNDVNVDLTRQCKNALDLAALAALHAVSVLLD
RSSHPDLEVFRIFDEAISALTEKLTWTLKAFRAGGFRDKAVQDDDDPVENIRARHRQEALQAELENRDSTSALLE
LRDIEDELLMLCQLFDQQSKVLSAMQGAYLRPERREHTANGRVFLSEALRRLRDDAQRAGDMVQRVRSTRDDYDK
LLQMVQRQAQVDEVRLSRLHADLAGAQSRSVTIFTTFTVIFLPLTFFTGLFGMNTRQWGGGGNLPLETIASVALP
SSFVLVAVALVIAYSSSARTLPRRAVGRLLGCMLRATRSADDGVPAGGEPARRRRVPDREGVSYPRGESEGGG
Coding >Ophio5|2953
ATGACCGTCGCGCCGCTGTCCGAGTCCGAGAGTGGCGAGAACGAGGCCAAGAAGAGCCATTACAGCTCTGACTCG
TCTGCCCGCTTCGTCGTCGATCCCGCTGGTGAGCGCACCTACGATGAAACGACCGTCGACGTCGTCACGGTGCCG
TGTCCCGGCGCCGATCCTCTTCAGAGCTGGAGTCGGGATGGGTTGGTGGGACGATACTTCGGCGCACCATCGATG
CGTGATGCCGAGGCCGTTCCGGCCCGTCACGGAGCTGCCTCCGGTCCGTCGTGGGTGCGGCAGGGCATCCGTCGG
GAGGCTCCCCGTGCGCGCATCCTGCTGTATGCGCATCCGGAGATGATGGCTGGCACCACTCTGGCCGACCTTGCC
GACTCCCTACTCGAGGAGCTGCGTGTGCTGAGGGTCGGTGAGGCGGCGGAGCGGCCACTCGTCTTCATCGCCCAT
AGCATCGGCGGTCTGGTCGTCAAGATGGCACTAACCAAGGCAGCGCGCGATGCCCGGTACGAGAGCGTGCTGCGC
GAGTGCTATGGCGTTGCCTTTTTCGGCACTCCTCATCAAGGCTCCAGCTACTTCGCCATGCACGGCCTTGCCGAC
AGCATCCAGAGCCTGCTCCGACTTTCGGCACCGCTGCCGGCTTCCATCACGGACAGCCTCCGTGTCGGAAACGAC
CTGCTACTGCGTGTCGACGACGACTTCAAGGCTGTTTCCCACGATGTGCGTATCTGGACACTCTACGAGACTATT
GAATCGCGCTTCGCCGCCCCCGAGCCTCGTTCCGACGACGTCTACTTCACCGCGCCCATCACCTCCAGCAAATCG
GCCATTCTCGGCATGCGCCAGGAGTCCATCTTCGCCCTTCAGAGCGATCACGCCAACATGGCCTCCTTTGGTCGC
CACAACGGCCGCGTCTTGCACCTTTTCCTGCGCCAGCTGGCTGTTCTCATCGCCCGCGCCGACATGGCCCTGCTC
CATGCCGCCGATGATGCTGTTGCTCGCTGGTCTCTCGATCTCGAGCGCAAGGTCAGCGTCGAGGTTCACGGCTTC
TTTGATGACGCGCCCGCTGCCGATGTCTCTACTATTCGAGCTTGGTCTACCCGCCTACCGCTCAGCGACTTTCTC
GCCAAGGGCCCTGTAACGTGCCTGAGCGAGCGCCTGAACGAGGTCGACGACGCTGACGCCAACACCGCCCCTGAT
GAGGGCCTTCAGTCTACCCCTGAGCGCCTGGAGCCGCCTCTGATGATGGTCCGGAACGCGCTGGGCATCCGAGCC
AGTCAGCCGGCTTCACCAGTGTCTCCTCATCTCCGTCCGTCTGACGTCGAACGTCGCCCCAACCCGCCGTCGCCC
CGAGACGCCTCACCCGCGACGGTGAGGTCAAGTTCGCCGACGCGTCCGTCGTCGTTGGTCCGGGCCGACCTGGAG
CAGGATCTGGCCGTCGATCGGCTCTCGCCCCCTTTGCGTCCGCGCATTGGCCGGGCCATTAGCCGGTCTTTCAGC
GACGGATTCTCGCGTCTCGAGTACCGTGAGTTTCTTGCCATGTCACCGCGCAGCCGCAGCGCCGTCGACGACGTC
ATTGCTGGCGCCCATGACGATGTCGACGATATCGAAGCGTCTCCCAAATTGCCGGAGGCTGTCGTTGCAATACGC
AATATCGTCAACATGGCAGGCGTCAGGAGCCGGGCTTTCGGATCGACCATGGCCAAGGAGCCGGCGCCGGCGTTT
GCAAAGCCGGATGTCAAAGCTCGGAGGTTTGTCTGGGTACATGTGCCTTTTAACAACCCGACCTGGGTCAAGAGC
GTGCTTCAGACACTCGAGGTGTCGTACGGCAGGAATCTTTCGGCGCTTTATGGCCACGACTTCTGGGCTACCAGA
CACACGCGAGGGAGACATCCTCAGCATTATGCCTACTTTGCAAAGCCTGGCTGTTACGTTCCCTCACCGCGAACA
CTCTCGTCAGGTTCGCGGACCGCCGCTGCAGCCAACGAAGCCGCCTACATGTGCCTTTTCCTGCCCTACCTGCAC
TTCGACTCGTACAGGCGGCTCATCAGGCGGCGAAACCTGATCCGGCAGCGGCTGCATCACGGACGGGCCCGGCCG
GTGCCTGAGTCGGTGGCCAAGTCGGATCTGCTGGAGCTCCAGGTGGTCTGGGAGTTTCTCGGCCACGACCCGCCG
GTCAACTGTCGCCGGACGTTGGATCAGTTTGGCCACCCGTCGCTGCGGGACACACGGTCTCGCGACGACGACCAA
ATGCTGTATAAGCTGACCAAAGACCGCGGCCTCGGCGCCGTGCCGGGGCCAGCTGCCGACGTCCGCAGCCAGGGC
TCCAGCGCGGGCACGGCGGGCGCCGCCTCGGACCGGGCCGGAAGCGGAGCCAGTACCACGTCCGGCGGCTGGCGC
GAACGACTTCTGCGCCGGGGCGGGACGGAGACGGCGGACGATGCGCCTGAGGAGGAGACGGTGCTGGACGGCAAG
GTGCTCATGGTCGACCAGCTCTGGCTCTGGGCCATTGACTCGCATACCCTGGTCTCGTTCTTCCCCAGGCGCGAG
AGCGATCCGATCGAGGGGCCGCTGTACCAGCAAGCAGACCTTCGGGACAGCATCTTCAACGACGTCAACGTCGAC
CTCACGCGACAGTGCAAGAACGCTCTTGATCTGGCGGCGCTGGCGGCGCTTCATGCCGTGAGCGTGCTTTTGGAT
CGGTCGTCGCACCCCGACCTCGAGGTGTTTCGCATCTTTGACGAGGCCATCAGTGCCCTGACGGAGAAGCTCACG
TGGACGCTCAAGGCGTTTCGCGCGGGGGGCTTCCGCGACAAGGCCGTCCAAGACGACGACGATCCTGTCGAGAAT
ATCAGGGCTCGCCACCGCCAGGAAGCGCTCCAGGCGGAGCTGGAGAACCGCGACAGCACCTCTGCGCTTCTGGAG
CTGCGCGACATCGAGGATGAGCTGCTAATGCTCTGCCAACTCTTCGACCAGCAGTCCAAGGTGCTCTCCGCCATG
CAAGGCGCCTACCTCCGGCCCGAGCGCCGCGAACACACGGCCAACGGCCGCGTCTTTTTGTCCGAGGCCCTGCGT
CGGCTGCGCGATGATGCCCAACGGGCGGGAGATATGGTGCAGCGGGTGCGAAGCACGCGAGACGACTACGATAAG
TTGCTACAGATGGTGCAGCGTCAGGCGCAGGTCGACGAGGTGAGGCTCAGCAGGCTTCACGCCGATCTCGCCGGT
GCGCAGAGTCGAAGCGTCACCATCTTCACCACTTTCACCGTCATCTTCCTACCCCTGACCTTCTTCACCGGCCTG
TTCGGCATGAACACGCGCCAATGGGGTGGTGGCGGCAATCTCCCACTGGAAACGATTGCCAGCGTCGCCCTGCCG
TCCAGCTTCGTCCTCGTCGCCGTCGCGCTTGTCATCGCCTACAGCTCCTCTGCCCGAACGCTGCCCCGTCGGGCC
GTGGGCCGTCTCCTCGGCTGCATGCTCCGGGCGACGCGTTCGGCAGACGACGGGGTGCCGGCGGGCGGAGAGCCG
GCCAGGCGGAGGCGCGTGCCCGACAGAGAGGGGGTATCGTATCCCCGAGGTGAATCGGAAGGTGGCGGC
Transcript >Ophio5|2953
ATGACCGTCGCGCCGCTGTCCGAGTCCGAGAGTGGCGAGAACGAGGCCAAGAAGAGCCATTACAGCTCTGACTCG
TCTGCCCGCTTCGTCGTCGATCCCGCTGGTGAGCGCACCTACGATGAAACGACCGTCGACGTCGTCACGGTGCCG
TGTCCCGGCGCCGATCCTCTTCAGAGCTGGAGTCGGGATGGGTTGGTGGGACGATACTTCGGCGCACCATCGATG
CGTGATGCCGAGGCCGTTCCGGCCCGTCACGGAGCTGCCTCCGGTCCGTCGTGGGTGCGGCAGGGCATCCGTCGG
GAGGCTCCCCGTGCGCGCATCCTGCTGTATGCGCATCCGGAGATGATGGCTGGCACCACTCTGGCCGACCTTGCC
GACTCCCTACTCGAGGAGCTGCGTGTGCTGAGGGTCGGTGAGGCGGCGGAGCGGCCACTCGTCTTCATCGCCCAT
AGCATCGGCGGTCTGGTCGTCAAGATGGCACTAACCAAGGCAGCGCGCGATGCCCGGTACGAGAGCGTGCTGCGC
GAGTGCTATGGCGTTGCCTTTTTCGGCACTCCTCATCAAGGCTCCAGCTACTTCGCCATGCACGGCCTTGCCGAC
AGCATCCAGAGCCTGCTCCGACTTTCGGCACCGCTGCCGGCTTCCATCACGGACAGCCTCCGTGTCGGAAACGAC
CTGCTACTGCGTGTCGACGACGACTTCAAGGCTGTTTCCCACGATGTGCGTATCTGGACACTCTACGAGACTATT
GAATCGCGCTTCGCCGCCCCCGAGCCTCGTTCCGACGACGTCTACTTCACCGCGCCCATCACCTCCAGCAAATCG
GCCATTCTCGGCATGCGCCAGGAGTCCATCTTCGCCCTTCAGAGCGATCACGCCAACATGGCCTCCTTTGGTCGC
CACAACGGCCGCGTCTTGCACCTTTTCCTGCGCCAGCTGGCTGTTCTCATCGCCCGCGCCGACATGGCCCTGCTC
CATGCCGCCGATGATGCTGTTGCTCGCTGGTCTCTCGATCTCGAGCGCAAGGTCAGCGTCGAGGTTCACGGCTTC
TTTGATGACGCGCCCGCTGCCGATGTCTCTACTATTCGAGCTTGGTCTACCCGCCTACCGCTCAGCGACTTTCTC
GCCAAGGGCCCTGTAACGTGCCTGAGCGAGCGCCTGAACGAGGTCGACGACGCTGACGCCAACACCGCCCCTGAT
GAGGGCCTTCAGTCTACCCCTGAGCGCCTGGAGCCGCCTCTGATGATGGTCCGGAACGCGCTGGGCATCCGAGCC
AGTCAGCCGGCTTCACCAGTGTCTCCTCATCTCCGTCCGTCTGACGTCGAACGTCGCCCCAACCCGCCGTCGCCC
CGAGACGCCTCACCCGCGACGGTGAGGTCAAGTTCGCCGACGCGTCCGTCGTCGTTGGTCCGGGCCGACCTGGAG
CAGGATCTGGCCGTCGATCGGCTCTCGCCCCCTTTGCGTCCGCGCATTGGCCGGGCCATTAGCCGGTCTTTCAGC
GACGGATTCTCGCGTCTCGAGTACCGTGAGTTTCTTGCCATGTCACCGCGCAGCCGCAGCGCCGTCGACGACGTC
ATTGCTGGCGCCCATGACGATGTCGACGATATCGAAGCGTCTCCCAAATTGCCGGAGGCTGTCGTTGCAATACGC
AATATCGTCAACATGGCAGGCGTCAGGAGCCGGGCTTTCGGATCGACCATGGCCAAGGAGCCGGCGCCGGCGTTT
GCAAAGCCGGATGTCAAAGCTCGGAGGTTTGTCTGGGTACATGTGCCTTTTAACAACCCGACCTGGGTCAAGAGC
GTGCTTCAGACACTCGAGGTGTCGTACGGCAGGAATCTTTCGGCGCTTTATGGCCACGACTTCTGGGCTACCAGA
CACACGCGAGGGAGACATCCTCAGCATTATGCCTACTTTGCAAAGCCTGGCTGTTACGTTCCCTCACCGCGAACA
CTCTCGTCAGGTTCGCGGACCGCCGCTGCAGCCAACGAAGCCGCCTACATGTGCCTTTTCCTGCCCTACCTGCAC
TTCGACTCGTACAGGCGGCTCATCAGGCGGCGAAACCTGATCCGGCAGCGGCTGCATCACGGACGGGCCCGGCCG
GTGCCTGAGTCGGTGGCCAAGTCGGATCTGCTGGAGCTCCAGGTGGTCTGGGAGTTTCTCGGCCACGACCCGCCG
GTCAACTGTCGCCGGACGTTGGATCAGTTTGGCCACCCGTCGCTGCGGGACACACGGTCTCGCGACGACGACCAA
ATGCTGTATAAGCTGACCAAAGACCGCGGCCTCGGCGCCGTGCCGGGGCCAGCTGCCGACGTCCGCAGCCAGGGC
TCCAGCGCGGGCACGGCGGGCGCCGCCTCGGACCGGGCCGGAAGCGGAGCCAGTACCACGTCCGGCGGCTGGCGC
GAACGACTTCTGCGCCGGGGCGGGACGGAGACGGCGGACGATGCGCCTGAGGAGGAGACGGTGCTGGACGGCAAG
GTGCTCATGGTCGACCAGCTCTGGCTCTGGGCCATTGACTCGCATACCCTGGTCTCGTTCTTCCCCAGGCGCGAG
AGCGATCCGATCGAGGGGCCGCTGTACCAGCAAGCAGACCTTCGGGACAGCATCTTCAACGACGTCAACGTCGAC
CTCACGCGACAGTGCAAGAACGCTCTTGATCTGGCGGCGCTGGCGGCGCTTCATGCCGTGAGCGTGCTTTTGGAT
CGGTCGTCGCACCCCGACCTCGAGGTGTTTCGCATCTTTGACGAGGCCATCAGTGCCCTGACGGAGAAGCTCACG
TGGACGCTCAAGGCGTTTCGCGCGGGGGGCTTCCGCGACAAGGCCGTCCAAGACGACGACGATCCTGTCGAGAAT
ATCAGGGCTCGCCACCGCCAGGAAGCGCTCCAGGCGGAGCTGGAGAACCGCGACAGCACCTCTGCGCTTCTGGAG
CTGCGCGACATCGAGGATGAGCTGCTAATGCTCTGCCAACTCTTCGACCAGCAGTCCAAGGTGCTCTCCGCCATG
CAAGGCGCCTACCTCCGGCCCGAGCGCCGCGAACACACGGCCAACGGCCGCGTCTTTTTGTCCGAGGCCCTGCGT
CGGCTGCGCGATGATGCCCAACGGGCGGGAGATATGGTGCAGCGGGTGCGAAGCACGCGAGACGACTACGATAAG
TTGCTACAGATGGTGCAGCGTCAGGCGCAGGTCGACGAGGTGAGGCTCAGCAGGCTTCACGCCGATCTCGCCGGT
GCGCAGAGTCGAAGCGTCACCATCTTCACCACTTTCACCGTCATCTTCCTACCCCTGACCTTCTTCACCGGCCTG
TTCGGCATGAACACGCGCCAATGGGGTGGTGGCGGCAATCTCCCACTGGAAACGATTGCCAGCGTCGCCCTGCCG
TCCAGCTTCGTCCTCGTCGCCGTCGCGCTTGTCATCGCCTACAGCTCCTCTGCCCGAACGCTGCCCCGTCGGGCC
GTGGGCCGTCTCCTCGGCTGCATGCTCCGGGCGACGCGTTCGGCAGACGACGGGGTGCCGGCGGGCGGAGAGCCG
GCCAGGCGGAGGCGCGTGCCCGACAGAGAGGGGGTATCGTATCCCCGAGGTGAATCGGAAGGTGGCGGCTAG
Gene >Ophio5|2953
ATGACCGTCGCGCCGCTGTCCGAGTCCGAGAGTGGCGAGAACGAGGCCAAGAAGAGCCATTACAGCTCTGACTCG
TCTGCCCGCTTCGTCGTCGATCCCGCTGGTGAGCGCACCTACGATGAAACGACCGTCGACGTCGTCACGGTGCCG
TGTCCCGGCGCCGATCCTCTTCAGAGCTGGAGTCGGGATGGGTTGGTGGGACGATACTTCGGCGCACCATCGATG
CGTGATGCCGAGGCCGTTCCGGCCCGTCACGGAGCTGCCTCCGGTCCGTCGTGGGTGCGGCAGGGCATCCGTCGG
GAGGCTCCCCGTGCGCGCATCCTGCTGTATGCGCATCCGGAGATGATGGCTGGCACCACTCTGGCCGACCTTGCC
GACTCCCTACTCGAGGAGCTGCGTGTGCTGAGGGTCGGTGAGGCGGCGGAGCGGCCACTCGTCTTCATCGCCCAT
AGCATCGGCGGTCTGGTCGTCAAGATGGCACTAACCAAGGCAGCGCGCGATGCCCGGTACGAGAGCGTGCTGCGC
GAGTGCTATGGCGTTGCCTTTTTCGGTGAGAATCTCTTGGTCCTGGCATCAATCCCCTTACAAGTCCCTAACACA
CCTACTTCTCAGGCACTCCTCATCAAGGCTCCAGCTACTTCGCCATGCACGGCCTTGCCGACAGCATCCAGAGCC
TGCTCCGACTTTCGGCACCGCTGCCGGCTTCCATCACGGACAGCCTCCGTGTCGGAAACGACCTGCTACTGCGTG
TCGACGACGACTTCAAGGCTGTTTCCCACGATGTGCGTATCTGGACACTCTACGAGACTATTGAATCGCGCTTCG
CCGCCCCCGAGCCTCGTTCCGACGACGTCTACTTCACCGCGCCCATCACCTCCAGCAAATCGGCCATTCTCGGCA
TGCGCCAGGAGTCCATCTTCGCCCTTCAGAGCGATCACGCCAACATGGCCTCCTTTGGTCGCCACAACGGCCGCG
TCTTGCACCTTTTCCTGCGCCAGCTGGCTGTTCTCATCGCCCGCGCCGACATGGCCCTGCTCCATGCCGCCGATG
ATGCTGTTGCTCGCTGGTCTCTCGATCTCGAGCGCAAGGTCAGCGTCGAGGTTCACGGCTTCTTTGATGACGCGC
CCGCTGCCGATGTCTCTACTATTCGAGCTTGGTCTACCCGCCTACCGCTCAGCGACTTTCTCGCCAAGGGCCCTG
TAACGTGCCTGAGCGAGCGCCTGAACGAGGTCGACGACGCTGACGCCAACACCGCCCCTGATGAGGGCCTTCAGT
CTACCCCTGAGCGCCTGGAGCCGCCTCTGATGATGGTCCGGAACGCGCTGGGCATCCGAGCCAGTCAGCCGGCTT
CACCAGTGTCTCCTCATCTCCGTCCGTCTGACGTCGAACGTCGCCCCAACCCGCCGTCGCCCCGAGACGCCTCAC
CCGCGACGGTGAGGTCAAGTTCGCCGACGCGTCCGTCGTCGTTGGTCCGGGCCGACCTGGAGCAGGATCTGGCCG
TCGATCGGCTCTCGCCCCCTTTGCGTCCGCGCATTGGCCGGGCCATTAGCCGGTCTTTCAGCGACGGATTCTCGC
GTCTCGAGTACCGTGAGTTTCTTGCCATGTCACCGCGCAGCCGCAGCGCCGTCGACGACGTCATTGCTGGCGCCC
ATGACGATGTCGACGATATCGAAGCGTCTCCCAAATTGCCGGAGGCTGTCGTTGCAATACGCAATATCGTCAACA
TGGCAGGCGTCAGGAGCCGGGCTTTCGGATCGACCATGGCCAAGGAGCCGGCGCCGGCGTTTGCAAAGCCGGATG
TCAAAGCTCGGAGGTTTGTCTGGGTACATGTGCCTTTTAACAACCCGACCTGGGTCAAGGTGAGAGAGCGGCCGT
AACACTTTGCGGGGGACCAAGGAGGTGCAGAGCTGATACGAATGACGGCCAGAGCGTGCTTCAGACACTCGAGGT
GTCGTACGGCAGGAATCTTTCGGCGCTTTATGGCCACGACTTCTGGGCTACCAGACACACGCGAGGGAGACATCC
TCAGCATTATGCCTACTTTGCAAAGCCTGGCTGTTACGTTCCCTCACCGCGAACACGCAAGTCTTTATTTCCCAG
CCGGCTCGAGAATCAAGGTGCTGACAGCAGCAGTCTCGTCAGGTTCGCGGACCGCCGCTGCAGCCAACGAAGCCG
CCTACATGTGCCTTTTCCTGCCCTACCTGCACTTCGACTCGTACAGGCGGCTCATCAGGCGGCGAAACCTGATCC
GGCAGCGGCTGCATCACGGACGGGCCCGGCCGGTGCCTGAGTCGGTGGCCAAGTCGGATCTGCTGGAGCTCCAGG
TGGTCTGGGAGTTTCTCGGCCACGACCCGCCGGTCAACTGTCGCCGGACGTTGGATCAGTTTGGCCACCCGTCGC
TGCGGGACACACGGTCTCGCGACGACGACCAAATGCTGTATAAGCTGACCAAAGACCGCGGCCTCGGCGCCGTGC
CGGGGCCAGCTGCCGACGTCCGCAGCCAGGGCTCCAGCGCGGGCACGGCGGGCGCCGCCTCGGACCGGGCCGGAA
GCGGAGCCAGTACCACGTCCGGCGGCTGGCGCGAACGACTTCTGCGCCGGGGCGGGACGGAGACGGCGGACGATG
CGCCTGAGGAGGAGACGGTGCTGGACGGCAAGGTGCTCATGGTCGACCAGCTCTGGCTCTGGGCCATTGACTCGC
GTACGTGAATGCCGACTCACAATCAAAAGGCTCAAACTGCCATCTAACGTCGCAGAAACAGATACCCTGGTCTCG
TTCTTCCCCAGGCGCGAGAGCGATCCGATCGAGGGGCCGCTGTACCAGCAAGCAGACCTTCGGGACAGCATCTTC
AACGACGTCAACGTCGACCTCACGCGACAGTGCAAGAACGCTCTTGATCTGGCGGCGCTGGCGGCGCTTCATGCC
GTGAGCGTGCTTTTGGATCGGTCGTCGCACCCCGACCTCGAGGTGTTTCGCATCTTTGACGAGGCCATCAGTGCC
CTGGTCCGTACTGCTCCTGGTTCTCTCCCAAATGCTACGGCTGACGACAGGGACACATAGACGGAGAAGCTCACG
TGGACGCTCAAGGCGTTTCGCGCGGGGGGCTTCCGCGACAAGGCCGTCCAAGACGACGACGATCCTGTCGAGAAT
ATCAGGGCTCGCCACCGCCAGGAAGCGCTCCAGGCGGAGCTGGAGAACCGCGACAGCACCTCTGCGCTTCTGGAG
CTGCGCGACATCGAGGATGAGCTGCTAATGCTCTGCCAACTCTTCGACCAGCAGTCCAAGGTGCTCTCCGCCATG
CAAGGCGCCTACCTCCGGCCCGAGCGCCGCGAACACACGGCCAACGGCCGCGTCTTTTTGTCCGAGGCCCTGCGT
CGGCTGCGCGATGATGCCCAACGGGCGGGAGATATGGTGCAGCGGGTGCGAAGCACGCGAGACGACTACGATAAG
TTGCTACAGATGGTGCAGCGTCAGGCGCAGGTCGACGAGGTGAGGCTCAGCAGGCTTCACGCCGATCTCGCCGGT
GCGCAGAGTCGAAGCGTCACCATCTTCACCACTTTCACCGTCATCTTCCTACCCCTGACCTTCTTCACCGGCCTG
TTCGGCATGAACACGCGCCAATGGGGTGGTGGCGGCAATCTCCCACTGGAAACGATTGCCAGCGTCGCCCTGCCG
TCCAGCTTCGTCCTCGTCGCCGTCGCGCTTGTCATCGCCTACAGCTCCTCTGCCCGAACGCTGCCCCGTCGGGCC
GTGGGCCGTCTCCTCGGCTGCATGCTCCGGGCGACGCGTTCGGCAGACGACGGGGTGCCGGCGGGCGGAGAGCCG
GCCAGGCGGAGGCGCGTGCCCGACAGAGAGGTTAGTGACTTTTGGGACAGGCATCGACTTGAGCGTGATAGGGGG
TATCGTATCCCCGAGGTGAATCGGAAGGTGGCGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail