Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2950
Gene name
Locationscaffold_235:13381..14972
Strand-
Gene length (bp)1591
Transcript length (bp)1488
Coding sequence length (bp)1485
Protein length (aa) 495

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 1.6E-12 11 135

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q15392|DHC24_HUMAN Delta(24)-sterol reductase OS=Homo sapiens GN=DHCR24 PE=1 SV=2 50 453 3.0E-49
sp|Q60HC5|DHC24_MACFA Delta(24)-sterol reductase OS=Macaca fascicularis GN=DHCR24 PE=2 SV=2 50 453 3.0E-49
sp|Q8VCH6|DHC24_MOUSE Delta(24)-sterol reductase OS=Mus musculus GN=Dhcr24 PE=1 SV=1 50 453 3.0E-48
sp|Q5BQE6|DHC24_RAT Delta(24)-sterol reductase OS=Rattus norvegicus GN=Dhcr24 PE=2 SV=2 50 453 4.0E-48
sp|O17397|DIML_CAEEL Diminuto-like protein OS=Caenorhabditis elegans GN=F52H2.6 PE=3 SV=1 37 445 1.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q15392|DHC24_HUMAN Delta(24)-sterol reductase OS=Homo sapiens GN=DHCR24 PE=1 SV=2 50 453 3.0E-49
sp|Q60HC5|DHC24_MACFA Delta(24)-sterol reductase OS=Macaca fascicularis GN=DHCR24 PE=2 SV=2 50 453 3.0E-49
sp|Q8VCH6|DHC24_MOUSE Delta(24)-sterol reductase OS=Mus musculus GN=Dhcr24 PE=1 SV=1 50 453 3.0E-48
sp|Q5BQE6|DHC24_RAT Delta(24)-sterol reductase OS=Rattus norvegicus GN=Dhcr24 PE=2 SV=2 50 453 4.0E-48
sp|O17397|DIML_CAEEL Diminuto-like protein OS=Caenorhabditis elegans GN=F52H2.6 PE=3 SV=1 37 445 1.0E-38
sp|Q39085|DIM_ARATH Delta(24)-sterol reductase OS=Arabidopsis thaliana GN=DIM PE=1 SV=2 46 459 2.0E-38
sp|P93472|DIM_PEA Delta(24)-sterol reductase OS=Pisum sativum GN=DIM PE=1 SV=1 46 459 2.0E-34
sp|Q5JLP4|CKX4_ORYSJ Cytokinin dehydrogenase 4 OS=Oryza sativa subsp. japonica GN=CKX4 PE=2 SV=1 4 224 1.0E-12
sp|Q75K78|CKX9_ORYSJ Cytokinin dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CKX9 PE=2 SV=1 74 205 6.0E-12
sp|Q7SGY1|ALO_NEUCR Putative D-arabinono-1,4-lactone oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alo-1 PE=3 SV=1 6 167 5.0E-11
sp|Q5Z620|CKX10_ORYSJ Cytokinin dehydrogenase 10 OS=Oryza sativa subsp. japonica GN=CKX10 PE=3 SV=1 9 175 2.0E-10
sp|A3AVP1|CKX8_ORYSJ Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. japonica GN=CKX8 PE=3 SV=1 75 175 3.0E-10
sp|A2XVN3|CKX8_ORYSI Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. indica GN=CKX8 PE=3 SV=1 75 175 3.0E-10
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 11 205 4.0E-10
sp|Q4ADV8|CKX2_ORYSJ Cytokinin dehydrogenase 2 OS=Oryza sativa subsp. japonica GN=CKX2 PE=2 SV=1 9 181 5.0E-10
sp|Q9LY71|CKX6_ARATH Cytokinin dehydrogenase 6 OS=Arabidopsis thaliana GN=CKX6 PE=2 SV=2 75 230 6.0E-10
sp|Q8LNV6|CKX3_ORYSJ Cytokinin dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=CKX3 PE=2 SV=1 75 175 4.0E-09
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 4 202 5.0E-09
sp|Q6YW50|CKX7_ORYSJ Cytokinin dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CKX7 PE=3 SV=1 4 202 4.0E-08
sp|O22213|CKX1_ARATH Cytokinin dehydrogenase 1 OS=Arabidopsis thaliana GN=CKX1 PE=1 SV=1 74 205 4.0E-07
sp|Q9FUJ2|CKX4_ARATH Cytokinin dehydrogenase 4 OS=Arabidopsis thaliana GN=CKX4 PE=1 SV=2 28 205 4.0E-07
sp|A0R607|DPRE1_MYCS2 FAD-dependent decaprenylphosphoryl-beta-D-ribofuranose 2-oxidase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=dprE1 PE=1 SV=2 40 156 6.0E-07
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 11 205 8.0E-07
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 7 225 9.0E-07
sp|Q67YU0|CKX5_ARATH Cytokinin dehydrogenase 5 OS=Arabidopsis thaliana GN=CKX5 PE=2 SV=1 75 205 1.0E-06
sp|Q6CG88|ALO_YARLI D-arabinono-1,4-lactone oxidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ALO1 PE=3 SV=1 30 167 2.0E-06
sp|P46377|FAS5_RHOFA Uncharacterized oxidoreductase ORF5 in fasciation locus OS=Rhodococcus fascians GN=fas5 PE=2 SV=1 8 202 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum 0.4547 0.1643 0.094 0.331 0.4103 0.3633 0.6824 0.2533 0.5774 0.2134

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1974
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|480
Ophiocordyceps camponoti-floridani Ophcf2|01593
Ophiocordyceps camponoti-rufipedis Ophun1|953
Ophiocordyceps kimflemingae Ophio5|2950 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2167
Ophiocordyceps subramaniannii Hirsu2|8520

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2950
MERHREAVAGISAVIRGLFQRQEPFRIAHGSTNSTRPRPHAGARVVDISGLSRVVSVDGASRTALVEPNVPMDRL
VEATLREGLVPPVVMEFPGITAGGGYAGTAGESSSFRHGFFDATLNRVEMILGNGEVVSASPTERPDLFSAAAGA
VGSLGVTTLLELRLVKARRWVRTTYRRTSSVAEAVATIRAATQNPDNDYVDGILFSPSHGAVISGRMTDDKPEDY
TPQTFSKAWDPWFYLHVRERTECQPEVTEYIPLAEYLFRYDRAGFWVGTQGWTYFHYLPFNRFFRWLLDDFMHTR
MLYRALHASGESSRFVIQDLAVPYDKADEFIDYTTHNFAIWPLWLCPLKQSSPPTFHPCSGAVPEGEDVLNVGLW
GWGPPDHEDFVSKNRALEDKLVELGGRKWLYAHTYYSEDEFWRVYGNRAWYEALRAKYHATTLPTVYDKVRIDVK
AARDERAASPWTSTWPFGGLYGIWKSIQSGSPTRDRRPCVAPPLC
Coding >Ophio5|2950
ATGGAGCGCCACAGGGAGGCCGTCGCCGGCATTTCCGCCGTCATTCGTGGCTTGTTCCAGCGTCAAGAACCGTTC
CGCATAGCTCATGGCAGTACGAACAGCACTCGTCCACGGCCTCATGCGGGCGCGAGAGTTGTCGATATCAGCGGC
CTTTCACGCGTCGTCTCCGTCGATGGCGCCTCCCGAACCGCGCTGGTCGAGCCAAACGTGCCCATGGACCGGCTG
GTTGAGGCGACGCTACGTGAGGGCCTCGTGCCGCCCGTTGTCATGGAGTTTCCCGGCATCACTGCTGGTGGAGGC
TACGCGGGCACTGCTGGCGAGAGCTCTTCGTTTCGCCATGGCTTCTTTGATGCCACACTCAACCGCGTCGAGATG
ATACTGGGCAATGGTGAAGTTGTCTCGGCCTCGCCGACTGAACGCCCGGATCTGTTCTCTGCCGCTGCTGGCGCT
GTCGGCTCCCTTGGTGTCACTACCCTTCTGGAGCTGCGTCTCGTCAAAGCCCGTCGCTGGGTCCGGACAACCTAC
CGTCGTACGTCGAGCGTTGCAGAGGCCGTCGCCACTATTCGTGCAGCGACGCAGAATCCGGACAACGACTATGTC
GACGGCATTCTCTTTTCGCCCAGCCACGGCGCCGTCATCTCCGGTCGCATGACGGACGACAAGCCCGAGGATTAC
ACGCCCCAAACCTTCAGCAAGGCCTGGGACCCCTGGTTCTACCTGCACGTCCGCGAGCGTACCGAATGTCAGCCA
GAAGTGACTGAGTACATCCCGCTCGCCGAGTACCTCTTCCGCTACGACCGTGCCGGCTTCTGGGTTGGCACCCAG
GGCTGGACCTATTTTCACTACCTCCCTTTCAACCGCTTCTTCCGCTGGCTCCTAGACGACTTTATGCACACGCGC
ATGCTCTACCGAGCCCTTCACGCCAGTGGCGAGTCGTCCCGTTTCGTCATTCAGGACCTCGCCGTCCCGTACGAC
AAAGCCGACGAGTTCATCGACTACACGACTCATAACTTTGCCATCTGGCCGCTCTGGCTGTGCCCGTTGAAGCAG
TCTTCGCCGCCGACTTTCCATCCCTGTTCTGGCGCGGTGCCAGAGGGCGAAGACGTGCTCAACGTCGGCCTCTGG
GGATGGGGTCCCCCGGACCACGAGGACTTTGTCAGCAAGAACCGCGCTCTTGAGGACAAGCTTGTCGAGCTCGGC
GGACGCAAGTGGCTCTACGCACACACGTACTACTCCGAGGACGAATTTTGGCGCGTCTACGGTAACAGAGCTTGG
TACGAAGCGCTGAGAGCCAAATATCATGCGACGACGCTCCCGACCGTCTACGACAAGGTGCGCATCGACGTCAAG
GCTGCTCGTGACGAACGTGCCGCTTCGCCCTGGACGAGCACATGGCCCTTTGGTGGGCTGTACGGAATATGGAAG
AGCATTCAGAGTGGGAGTCCGACGAGAGACCGTCGCCCTTGCGTGGCGCCACCATTGTGC
Transcript >Ophio5|2950
ATGGAGCGCCACAGGGAGGCCGTCGCCGGCATTTCCGCCGTCATTCGTGGCTTGTTCCAGCGTCAAGAACCGTTC
CGCATAGCTCATGGCAGTACGAACAGCACTCGTCCACGGCCTCATGCGGGCGCGAGAGTTGTCGATATCAGCGGC
CTTTCACGCGTCGTCTCCGTCGATGGCGCCTCCCGAACCGCGCTGGTCGAGCCAAACGTGCCCATGGACCGGCTG
GTTGAGGCGACGCTACGTGAGGGCCTCGTGCCGCCCGTTGTCATGGAGTTTCCCGGCATCACTGCTGGTGGAGGC
TACGCGGGCACTGCTGGCGAGAGCTCTTCGTTTCGCCATGGCTTCTTTGATGCCACACTCAACCGCGTCGAGATG
ATACTGGGCAATGGTGAAGTTGTCTCGGCCTCGCCGACTGAACGCCCGGATCTGTTCTCTGCCGCTGCTGGCGCT
GTCGGCTCCCTTGGTGTCACTACCCTTCTGGAGCTGCGTCTCGTCAAAGCCCGTCGCTGGGTCCGGACAACCTAC
CGTCGTACGTCGAGCGTTGCAGAGGCCGTCGCCACTATTCGTGCAGCGACGCAGAATCCGGACAACGACTATGTC
GACGGCATTCTCTTTTCGCCCAGCCACGGCGCCGTCATCTCCGGTCGCATGACGGACGACAAGCCCGAGGATTAC
ACGCCCCAAACCTTCAGCAAGGCCTGGGACCCCTGGTTCTACCTGCACGTCCGCGAGCGTACCGAATGTCAGCCA
GAAGTGACTGAGTACATCCCGCTCGCCGAGTACCTCTTCCGCTACGACCGTGCCGGCTTCTGGGTTGGCACCCAG
GGCTGGACCTATTTTCACTACCTCCCTTTCAACCGCTTCTTCCGCTGGCTCCTAGACGACTTTATGCACACGCGC
ATGCTCTACCGAGCCCTTCACGCCAGTGGCGAGTCGTCCCGTTTCGTCATTCAGGACCTCGCCGTCCCGTACGAC
AAAGCCGACGAGTTCATCGACTACACGACTCATAACTTTGCCATCTGGCCGCTCTGGCTGTGCCCGTTGAAGCAG
TCTTCGCCGCCGACTTTCCATCCCTGTTCTGGCGCGGTGCCAGAGGGCGAAGACGTGCTCAACGTCGGCCTCTGG
GGATGGGGTCCCCCGGACCACGAGGACTTTGTCAGCAAGAACCGCGCTCTTGAGGACAAGCTTGTCGAGCTCGGC
GGACGCAAGTGGCTCTACGCACACACGTACTACTCCGAGGACGAATTTTGGCGCGTCTACGGTAACAGAGCTTGG
TACGAAGCGCTGAGAGCCAAATATCATGCGACGACGCTCCCGACCGTCTACGACAAGGTGCGCATCGACGTCAAG
GCTGCTCGTGACGAACGTGCCGCTTCGCCCTGGACGAGCACATGGCCCTTTGGTGGGCTGTACGGAATATGGAAG
AGCATTCAGAGTGGGAGTCCGACGAGAGACCGTCGCCCTTGCGTGGCGCCACCATTGTGCTAG
Gene >Ophio5|2950
ATGGAGCGCCACAGGGAGGCCGTCGCCGGCATTTCCGCCGTCATTCGTGGCTTGTTCCAGCGTCAAGAACCGTTC
CGCATAGCTCATGGCAGTACGAACAGCACTCGTCCACGGCCTCATGCGGGCGCGAGAGTTGTCGATATCAGCGGC
CTTTCACGCGTCGTCTCCGTCGATGGCGCCTCCCGAACCGCGCTGGTCGAGCCAAACGTGCCCATGGACCGGCTG
GTTGAGGCGACGCTACGTGAGGGCCTCGTGCCGCCCGTTGTCATGGAGTTTCCCGGCATCACTGCTGGTGGAGGC
TACGCGGGCACTGCTGGCGAGAGCTCTTCGTTTCGCCATGGCTTCTTTGATGCCACACTCAACCGCGTCGAGATG
ATACTGGGCAATGGTGAAGTTGTCTCGGCCTCGCCGACTGAACGCCCGGATCTGTTCTCTGCCGCTGCTGGCGCT
GTCGGCTCCCTTGGTGTCACTACCCTTCTGGAGCTGCGTCTCGTCAAAGCCCGTCGCTGGGTCCGGACAACCTAC
CGTCGTACGTCGAGCGTTGCAGAGGCCGTCGCCACTATTCGTGCAGCGACGCAGAATCCGGACAACGACTATGTC
GACGGCATTCTCTTTTCGCCCAGCCACGGCGCCGTCATCTCCGGTCGCATGACGGACGACAAGCCCGAGGATTAC
ACGCCCCAAACCTTCAGCAAGGCCTGGGACCCCTGGTTCTACCTGCACGTCCGCGAGCGTACCGAATGTCAGCCA
GAAGTGACTGAGTACATCCCGCTCGCCGAGTACCTCTTCCGCTACGACCGTGCCGGCTTCTGGGTTGGCACCCAG
GGCTGGACCTATTTTCACTACCTCCCTTTCAACCGCTTCTTCCGCTGGCTCCTAGACGACTTTATGCACACGCGC
ATGCTCTACCGAGCCCTTCACGCCAGTGGCGAGTCGTCCCGTTTCGTCATTCAGGACCTCGCCGTCCCGTACGAC
AAAGCCGACGAGTTCATCGACTACACGACTCATAACTTTGCCATCTGGCCGCTCTGGCTGTGCCCGTTGAAGCAG
TCTTCGCCGCCGACTTTCCATCCCTGTTCTGGCGCGGTGCCAGAGGGCGAAGACGTGCTCAACGTCGGCCTCTGG
GGATGGGGTCCCCCGGACCACGAGGACTTTGTCAGCAAGAACCGCGCTCTTGAGGACAAGCTTGTCGAGCTCGGC
GGACGCAAGTGGCTCTACGCACACACGTACTACTCCGAGGACGAATTTTGGCGCGTCTACGGTAACAGAGCTTGG
TACGAAGCGCTGAGAGCCAAATATCATGCGACGACGCTCCCGACCGTCTACGACAAGGTGCGCATCGACGTCAAG
GCTGCTCGTGACGAACGTGCCGCTTCGCCCTGGACGAGCACATGGCCCTTTGGTGGGCTGTACGGAATATGGAAG
AGCATTCAGAGTGGTGACTATCACCTGCACCGCAACGCCGGCTGGAAACACCGATGAGGGAGTCCGACGAGAGAC
CGTGAGATGACGTGTGGCGCCGGATGCGTATACCCTTTCACATGACTGACACTTGCTAGGTCGCCCTTGCGTGGC
GCCACCATTGTGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail