Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2947
Gene name
Locationscaffold_235:5969..7582
Strand-
Gene length (bp)1613
Transcript length (bp)1545
Coding sequence length (bp)1542
Protein length (aa) 514

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum 0.4659 0.1832 0.0484 0.1274 0.286 0.12 0.8904 0.1376 0.4368 0.011

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup296
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|00022
Ophiocordyceps camponoti-floridani Ophcf2|01596
Ophiocordyceps camponoti-floridani Ophcf2|06712
Ophiocordyceps camponoti-rufipedis Ophun1|1283
Ophiocordyceps camponoti-rufipedis Ophun1|2810
Ophiocordyceps camponoti-rufipedis Ophun1|950
Ophiocordyceps kimflemingae Ophio5|2947 (this protein)
Ophiocordyceps kimflemingae Ophio5|4080
Ophiocordyceps kimflemingae Ophio5|6414
Ophiocordyceps subramaniannii Hirsu2|9518

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2947
MAEKDSTLYIEDDDVYPLYTFDDGKYNRKLLSWVMRFNDVLDPKKLNDSLSRLLEIGDWRKLGGRLKLRESGKLE
IHAPKQFSASRPAVSFSHNDFSGVPIEEHPIACRFPEPTIEPSIQPIRDFGPFLAPQGYPKTIEEMISRRLPQIS
LHVTSFRNATLVALAWPHTLMDAIGHQELLRGWSLVLAGREHHVPPLLGARKDILKELEDEEGETEREPFALKRH
RIGRLGIFALLARFLWDKFWSAPLELRAIYLPTKALARLQSTAQQQIDQLAKDTKHGSFVSEGDVLTAWTAQAIA
QTRPGLRPVTLVNFFNLRYRLPRLRDEASGVYIQNMTQMNYTFCSPQLARGALGHLALQNRRQLVEQTSTQQSLS
LMRSMRQRLEAGKGLNVFYGETNALPIFCNNLTKVDLIKAADFAPAVLTRGDCKENRVNPPGTMIMYYNQLVEET
TRGPDCVYVLGKDYGGNYWLLGNLLPQTWTRLDEDLQKLKGEAIKLSQEQETELKDGAMYSCFG
Coding >Ophio5|2947
ATGGCGGAGAAAGACTCAACTCTTTATATCGAAGACGACGATGTGTATCCTCTATACACGTTCGACGATGGGAAG
TACAACCGCAAGCTCTTATCATGGGTGATGCGGTTCAATGATGTTCTGGATCCGAAGAAATTAAATGACAGCCTC
TCAAGGCTCCTGGAGATTGGCGATTGGAGAAAGCTCGGTGGGAGGCTGAAGCTCAGAGAGTCTGGAAAGCTAGAG
ATTCATGCTCCGAAACAGTTTTCGGCCAGCCGACCAGCCGTGTCCTTCTCTCATAATGACTTCTCTGGAGTGCCG
ATCGAGGAGCACCCGATAGCCTGTCGATTCCCCGAGCCGACTATCGAGCCATCTATTCAGCCAATTCGGGACTTT
GGCCCATTTCTTGCGCCGCAAGGCTACCCCAAGACAATCGAGGAAATGATTAGCCGACGTTTGCCTCAAATATCG
TTACACGTCACTTCATTTCGCAATGCAACCCTCGTCGCGCTTGCGTGGCCTCATACCCTCATGGATGCCATAGGC
CATCAAGAATTGCTGCGTGGCTGGTCTCTTGTGCTAGCTGGGCGCGAACACCATGTTCCGCCTCTGCTCGGCGCC
CGGAAGGATATTCTCAAGGAACTGGAAGACGAAGAGGGCGAAACAGAGAGGGAACCATTCGCTCTCAAGCGGCAT
CGCATCGGGAGACTGGGCATCTTTGCCTTGCTCGCACGGTTTCTGTGGGACAAGTTCTGGAGCGCTCCGTTAGAG
CTACGAGCCATCTATCTCCCTACCAAAGCTCTCGCACGGTTGCAAAGTACGGCTCAGCAACAGATCGACCAACTG
GCCAAGGATACCAAGCATGGTAGTTTCGTCAGCGAAGGCGATGTACTCACAGCATGGACCGCTCAGGCGATAGCG
CAAACCAGACCAGGACTACGACCCGTCACGCTCGTCAACTTTTTCAACCTTCGCTATCGGCTTCCACGGCTACGT
GATGAGGCATCAGGTGTATACATACAGAACATGACACAAATGAACTATACCTTCTGTTCGCCTCAGCTTGCCAGG
GGAGCTCTTGGACATTTGGCGCTGCAGAATCGACGTCAACTGGTCGAGCAGACATCGACACAGCAGAGTCTGAGC
CTAATGCGGAGTATGCGGCAGAGACTCGAAGCGGGAAAGGGGTTGAACGTTTTTTACGGCGAGACGAATGCTCTG
CCCATCTTTTGCAATAACTTGACCAAGGTCGACCTCATCAAAGCTGCTGATTTTGCGCCAGCAGTTTTGACTCGG
GGCGACTGCAAAGAGAACAGAGTAAATCCACCAGGCACTATGATCATGTATTATAATCAGCTTGTCGAAGAAACC
ACGCGAGGTCCAGACTGCGTTTACGTGCTCGGAAAGGATTACGGGGGAAACTACTGGCTTCTAGGCAACTTACTT
CCCCAAACGTGGACGAGGCTTGACGAGGATTTACAAAAACTAAAGGGGGAAGCAATCAAGTTATCCCAAGAGCAG
GAGACGGAGTTGAAGGATGGCGCCATGTATTCCTGCTTTGGC
Transcript >Ophio5|2947
ATGGCGGAGAAAGACTCAACTCTTTATATCGAAGACGACGATGTGTATCCTCTATACACGTTCGACGATGGGAAG
TACAACCGCAAGCTCTTATCATGGGTGATGCGGTTCAATGATGTTCTGGATCCGAAGAAATTAAATGACAGCCTC
TCAAGGCTCCTGGAGATTGGCGATTGGAGAAAGCTCGGTGGGAGGCTGAAGCTCAGAGAGTCTGGAAAGCTAGAG
ATTCATGCTCCGAAACAGTTTTCGGCCAGCCGACCAGCCGTGTCCTTCTCTCATAATGACTTCTCTGGAGTGCCG
ATCGAGGAGCACCCGATAGCCTGTCGATTCCCCGAGCCGACTATCGAGCCATCTATTCAGCCAATTCGGGACTTT
GGCCCATTTCTTGCGCCGCAAGGCTACCCCAAGACAATCGAGGAAATGATTAGCCGACGTTTGCCTCAAATATCG
TTACACGTCACTTCATTTCGCAATGCAACCCTCGTCGCGCTTGCGTGGCCTCATACCCTCATGGATGCCATAGGC
CATCAAGAATTGCTGCGTGGCTGGTCTCTTGTGCTAGCTGGGCGCGAACACCATGTTCCGCCTCTGCTCGGCGCC
CGGAAGGATATTCTCAAGGAACTGGAAGACGAAGAGGGCGAAACAGAGAGGGAACCATTCGCTCTCAAGCGGCAT
CGCATCGGGAGACTGGGCATCTTTGCCTTGCTCGCACGGTTTCTGTGGGACAAGTTCTGGAGCGCTCCGTTAGAG
CTACGAGCCATCTATCTCCCTACCAAAGCTCTCGCACGGTTGCAAAGTACGGCTCAGCAACAGATCGACCAACTG
GCCAAGGATACCAAGCATGGTAGTTTCGTCAGCGAAGGCGATGTACTCACAGCATGGACCGCTCAGGCGATAGCG
CAAACCAGACCAGGACTACGACCCGTCACGCTCGTCAACTTTTTCAACCTTCGCTATCGGCTTCCACGGCTACGT
GATGAGGCATCAGGTGTATACATACAGAACATGACACAAATGAACTATACCTTCTGTTCGCCTCAGCTTGCCAGG
GGAGCTCTTGGACATTTGGCGCTGCAGAATCGACGTCAACTGGTCGAGCAGACATCGACACAGCAGAGTCTGAGC
CTAATGCGGAGTATGCGGCAGAGACTCGAAGCGGGAAAGGGGTTGAACGTTTTTTACGGCGAGACGAATGCTCTG
CCCATCTTTTGCAATAACTTGACCAAGGTCGACCTCATCAAAGCTGCTGATTTTGCGCCAGCAGTTTTGACTCGG
GGCGACTGCAAAGAGAACAGAGTAAATCCACCAGGCACTATGATCATGTATTATAATCAGCTTGTCGAAGAAACC
ACGCGAGGTCCAGACTGCGTTTACGTGCTCGGAAAGGATTACGGGGGAAACTACTGGCTTCTAGGCAACTTACTT
CCCCAAACGTGGACGAGGCTTGACGAGGATTTACAAAAACTAAAGGGGGAAGCAATCAAGTTATCCCAAGAGCAG
GAGACGGAGTTGAAGGATGGCGCCATGTATTCCTGCTTTGGCTGA
Gene >Ophio5|2947
ATGGCGGAGAAAGACTCAACTCTTTATATCGAAGACGACGATGTGTATCCTCTATACACGTTCGACGATGGGAAG
TACAACCGCAAGCTCTTATCATGGGTGATGCGGTTCAATGATGTTCTGGATCCGAAGAAATTAAATGACAGCCTC
TCAAGGCTCCTGGAGATTGGCGATTGGAGAAAGCTCGGTGGGAGGCTGAAGCTCAGAGTATGTATGGACGCAGAC
CAGAACCCCCTAATCCAATAAGTAACTTGCTTCTGGCATTGCGCCTGTAGGAGTCTGGAAAGCTAGAGATTCATG
CTCCGAAACAGTTTTCGGCCAGCCGACCAGCCGTGTCCTTCTCTCATAATGACTTCTCTGGAGTGCCGATCGAGG
AGCACCCGATAGCCTGTCGATTCCCCGAGCCGACTATCGAGCCATCTATTCAGCCAATTCGGGACTTTGGCCCAT
TTCTTGCGCCGCAAGGCTACCCCAAGACAATCGAGGAAATGATTAGCCGACGTTTGCCTCAAATATCGTTACACG
TCACTTCATTTCGCAATGCAACCCTCGTCGCGCTTGCGTGGCCTCATACCCTCATGGATGCCATAGGCCATCAAG
AATTGCTGCGTGGCTGGTCTCTTGTGCTAGCTGGGCGCGAACACCATGTTCCGCCTCTGCTCGGCGCCCGGAAGG
ATATTCTCAAGGAACTGGAAGACGAAGAGGGCGAAACAGAGAGGGAACCATTCGCTCTCAAGCGGCATCGCATCG
GGAGACTGGGCATCTTTGCCTTGCTCGCACGGTTTCTGTGGGACAAGTTCTGGAGCGCTCCGTTAGAGCTACGAG
CCATCTATCTCCCTACCAAAGCTCTCGCACGGTTGCAAAGTACGGCTCAGCAACAGATCGACCAACTGGCCAAGG
ATACCAAGCATGGTAGTTTCGTCAGCGAAGGCGATGTACTCACAGCATGGACCGCTCAGGCGATAGCGCAAACCA
GACCAGGACTACGACCCGTCACGCTCGTCAACTTTTTCAACCTTCGCTATCGGCTTCCACGGCTACGTGATGAGG
CATCAGGTGTATACATACAGAACATGACACAAATGAACTATACCTTCTGTTCGCCTCAGCTTGCCAGGGGAGCTC
TTGGACATTTGGCGCTGCAGAATCGACGTCAACTGGTCGAGCAGACATCGACACAGCAGAGTCTGAGCCTAATGC
GGAGTATGCGGCAGAGACTCGAAGCGGGAAAGGGGTTGAACGTTTTTTACGGCGAGACGAATGCTCTGCCCATCT
TTTGCAATAACTTGACCAAGGTCGACCTCATCAAAGCTGCTGATTTTGCGCCAGCAGTTTTGACTCGGGGCGACT
GCAAAGAGAACAGAGTAAATCCACCAGGCACTATGATCATGTATTATAATCAGCTTGTCGAAGAAACCACGCGAG
GTCCAGACTGCGTTTACGTGCTCGGAAAGGATTACGGGGGAAACTACTGGCTTCTAGGCAACTTACTTCCCCAAA
CGTGGACGAGGCTTGACGAGGATTTACAAAAACTAAAGGGGGAAGCAATCAAGTTATCCCAAGAGCAGGAGACGG
AGTTGAAGGATGGCGCCATGTATTCCTGCTTTGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail