Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2939
Gene name
Locationscaffold_234:15247..17767
Strand+
Gene length (bp)2520
Transcript length (bp)2520
Coding sequence length (bp)2517
Protein length (aa) 839

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11885 DUF3405 Protein of unknown function (DUF3405) 1.1E-227 247 817

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 95 117 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 73.98 39.10 108.85
CcL In ants, during behavior modification 109.58 50.06 169.09
CcD In ants, recently dead 94.81 47.79 141.82

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.121495 no
SC16a CcD 0.330568 no
CcL CcD 0.621717 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2939
MGAVSNPLRSREHRLPLYQKIDPSTKDRYSDDGFESPISDTESDHTLATVSPCRSRDISHSVSKGHFLLSRRRPV
LSTRKAGLYPYRLPARVSRYVFLGVLGILVLMILSLIRASQVENWKVVNGKVSLAPAPAPVWEQFPFLERYYGGL
RHLKPFHESEPEYPRPAESRTPPSSRGRITARADIPLSKSWQHFPGRSTESGIQECFLDAAGNIRPPPLRYYEGR
PLGFPENVAGSYEVLKLPQDICFERFGRLGPYGLGYSARAGGLGTSEYGDKEGSEAVWDKTRPVDFRHVDWAHVQ
RQCFNANAGRFRELPVSTPAPHGFYVANSRSSSIRHRNVVSNGSSGHANAPRSDEADGKIEKQARTAVVVRCWDE
YLFREDDIANMRAMITELSLASGGRYDVHLLVQVKNDAHNPIWADHEAYEKRIRDSVPEEFRGLVTLWTETQMLS
LYQGIYDLWSRGPGLPVHGVYRGLSMAMQYFAYQHPEYDFFWQWEMDIRYTGHYHDLLSKIEDWAKEQPRKGLWE
RNSRFYFPSVHGSWDDFSQMTRVQTEMSASGLDNDKVLGKVGSAAKKASELVSNKGKPVWGPLRPSDANDWFETE
EDGMPETEYEADRYQWGVGEEADYISLNPLFDPEGTTWLLKDDITGFNGSHPLPPRRASIITTARMSRRLLMAMH
RTTAYKKQFAFPEMWPATVALHHGFKSVFAPHPMYVDRKWPVKYMAQVYNGGRDGTSGGSRTSIFGEREHNMHGI
TWFYNSGFAPNLYRRWLGLKVNNDGGPDFETTTDASKQGKGGGGVGAMPGGEGRMCLPPMLLHPVKDVEQPVEDV
AVTEGELPITDPAA
Coding >Ophio5|2939
ATGGGGGCTGTCTCAAACCCTCTGCGCTCTCGCGAGCATCGGCTGCCGCTGTACCAGAAGATCGACCCGTCTACC
AAGGATAGATATTCAGACGACGGCTTCGAGTCGCCCATATCCGACACCGAGTCCGATCATACGCTCGCTACTGTG
TCGCCTTGCCGATCTCGCGATATCTCCCACTCGGTCTCCAAGGGCCACTTTCTGCTGTCGAGGCGCCGGCCCGTC
CTCTCTACCCGCAAGGCCGGCCTTTATCCCTATCGCCTGCCCGCCAGGGTTTCGCGCTATGTCTTCCTTGGCGTG
CTGGGCATCCTCGTCCTCATGATACTCAGCCTGATACGCGCCAGTCAGGTCGAAAACTGGAAAGTGGTCAATGGC
AAGGTCAGCTTGGCGCCCGCGCCCGCGCCCGTCTGGGAGCAGTTCCCCTTCCTCGAGAGATACTACGGCGGTCTG
CGGCACTTGAAGCCCTTTCATGAGAGCGAGCCCGAATATCCGCGCCCGGCTGAGTCTCGAACTCCGCCGTCGTCT
CGGGGGCGCATTACGGCGCGAGCGGACATTCCCCTGAGCAAGTCTTGGCAGCACTTCCCTGGGAGGAGCACCGAG
TCGGGCATCCAAGAGTGTTTCCTTGATGCCGCTGGCAACATACGGCCCCCCCCTCTACGCTACTACGAGGGGCGC
CCCCTCGGCTTTCCGGAAAATGTGGCCGGCTCCTACGAGGTGCTGAAATTGCCGCAAGACATCTGCTTTGAGCGC
TTCGGCCGGCTCGGCCCGTACGGCTTGGGGTACTCCGCCCGCGCTGGTGGCCTGGGCACGAGCGAGTACGGCGAC
AAGGAAGGGTCTGAGGCGGTATGGGACAAGACACGGCCTGTCGACTTTCGCCACGTCGATTGGGCCCACGTCCAG
CGCCAATGCTTCAATGCGAATGCCGGACGCTTCCGTGAGCTGCCGGTGTCGACGCCGGCGCCGCATGGCTTCTAC
GTGGCGAATTCTCGGTCCTCGAGCATCCGACACCGAAATGTCGTTTCCAACGGTTCCAGCGGCCACGCCAATGCC
CCGAGAAGCGACGAGGCGGACGGCAAAATCGAGAAACAAGCCAGGACGGCCGTCGTCGTCCGATGCTGGGACGAG
TACTTGTTCCGCGAGGACGACATCGCCAATATGCGAGCCATGATCACTGAACTATCCCTGGCATCGGGTGGACGG
TACGACGTGCATCTGCTCGTGCAAGTCAAGAACGACGCCCACAACCCCATCTGGGCAGATCATGAAGCCTATGAG
AAGCGGATCCGCGATAGCGTGCCTGAGGAGTTTCGAGGATTGGTCACGCTCTGGACCGAGACGCAGATGTTGTCG
CTTTACCAGGGCATCTACGACTTGTGGAGTCGGGGCCCCGGGCTGCCCGTTCACGGCGTCTATCGAGGATTGTCG
ATGGCGATGCAGTATTTCGCCTATCAGCACCCGGAGTATGACTTCTTCTGGCAGTGGGAGATGGATATACGCTAC
ACTGGCCACTATCACGACCTACTGAGCAAGATCGAGGACTGGGCCAAGGAACAGCCGAGGAAGGGCCTCTGGGAG
CGCAATTCGCGCTTTTACTTTCCCTCCGTTCACGGCTCATGGGACGACTTTTCGCAGATGACACGCGTGCAGACG
GAGATGAGCGCGAGCGGGTTGGACAACGACAAGGTCCTCGGCAAGGTGGGCAGTGCAGCCAAGAAAGCATCCGAG
CTAGTGAGCAACAAAGGCAAGCCGGTATGGGGTCCCCTTCGACCCTCGGATGCCAATGACTGGTTCGAGACGGAG
GAGGACGGCATGCCCGAGACGGAATACGAAGCCGATCGCTACCAGTGGGGCGTGGGCGAAGAAGCCGACTACATC
TCGCTGAACCCCCTCTTCGATCCGGAGGGCACAACCTGGCTGCTCAAGGACGACATCACGGGCTTCAACGGGTCG
CATCCGCTGCCCCCTCGCCGAGCATCCATCATCACGACGGCTCGCATGTCGCGCCGGCTGCTCATGGCCATGCAC
CGGACGACGGCGTACAAGAAGCAGTTTGCCTTTCCCGAGATGTGGCCGGCGACGGTAGCCCTCCACCACGGCTTC
AAGTCGGTCTTTGCGCCTCACCCCATGTACGTCGACAGGAAGTGGCCGGTCAAGTACATGGCGCAGGTCTACAAC
GGCGGCCGAGACGGCACAAGCGGAGGCTCGCGGACGAGCATCTTCGGCGAGCGCGAGCACAACATGCACGGCATC
ACCTGGTTCTACAACTCGGGCTTCGCGCCCAACCTGTACCGTCGCTGGCTCGGCCTCAAGGTCAACAACGACGGC
GGCCCCGACTTTGAGACGACGACGGATGCCTCCAAGCAGGGCAAAGGAGGCGGCGGCGTTGGTGCCATGCCCGGC
GGTGAGGGCCGTATGTGTCTGCCGCCCATGCTGCTGCATCCCGTCAAGGATGTGGAGCAGCCGGTCGAGGACGTT
GCGGTCACAGAGGGCGAGCTGCCCATCACGGATCCAGCAGCG
Transcript >Ophio5|2939
ATGGGGGCTGTCTCAAACCCTCTGCGCTCTCGCGAGCATCGGCTGCCGCTGTACCAGAAGATCGACCCGTCTACC
AAGGATAGATATTCAGACGACGGCTTCGAGTCGCCCATATCCGACACCGAGTCCGATCATACGCTCGCTACTGTG
TCGCCTTGCCGATCTCGCGATATCTCCCACTCGGTCTCCAAGGGCCACTTTCTGCTGTCGAGGCGCCGGCCCGTC
CTCTCTACCCGCAAGGCCGGCCTTTATCCCTATCGCCTGCCCGCCAGGGTTTCGCGCTATGTCTTCCTTGGCGTG
CTGGGCATCCTCGTCCTCATGATACTCAGCCTGATACGCGCCAGTCAGGTCGAAAACTGGAAAGTGGTCAATGGC
AAGGTCAGCTTGGCGCCCGCGCCCGCGCCCGTCTGGGAGCAGTTCCCCTTCCTCGAGAGATACTACGGCGGTCTG
CGGCACTTGAAGCCCTTTCATGAGAGCGAGCCCGAATATCCGCGCCCGGCTGAGTCTCGAACTCCGCCGTCGTCT
CGGGGGCGCATTACGGCGCGAGCGGACATTCCCCTGAGCAAGTCTTGGCAGCACTTCCCTGGGAGGAGCACCGAG
TCGGGCATCCAAGAGTGTTTCCTTGATGCCGCTGGCAACATACGGCCCCCCCCTCTACGCTACTACGAGGGGCGC
CCCCTCGGCTTTCCGGAAAATGTGGCCGGCTCCTACGAGGTGCTGAAATTGCCGCAAGACATCTGCTTTGAGCGC
TTCGGCCGGCTCGGCCCGTACGGCTTGGGGTACTCCGCCCGCGCTGGTGGCCTGGGCACGAGCGAGTACGGCGAC
AAGGAAGGGTCTGAGGCGGTATGGGACAAGACACGGCCTGTCGACTTTCGCCACGTCGATTGGGCCCACGTCCAG
CGCCAATGCTTCAATGCGAATGCCGGACGCTTCCGTGAGCTGCCGGTGTCGACGCCGGCGCCGCATGGCTTCTAC
GTGGCGAATTCTCGGTCCTCGAGCATCCGACACCGAAATGTCGTTTCCAACGGTTCCAGCGGCCACGCCAATGCC
CCGAGAAGCGACGAGGCGGACGGCAAAATCGAGAAACAAGCCAGGACGGCCGTCGTCGTCCGATGCTGGGACGAG
TACTTGTTCCGCGAGGACGACATCGCCAATATGCGAGCCATGATCACTGAACTATCCCTGGCATCGGGTGGACGG
TACGACGTGCATCTGCTCGTGCAAGTCAAGAACGACGCCCACAACCCCATCTGGGCAGATCATGAAGCCTATGAG
AAGCGGATCCGCGATAGCGTGCCTGAGGAGTTTCGAGGATTGGTCACGCTCTGGACCGAGACGCAGATGTTGTCG
CTTTACCAGGGCATCTACGACTTGTGGAGTCGGGGCCCCGGGCTGCCCGTTCACGGCGTCTATCGAGGATTGTCG
ATGGCGATGCAGTATTTCGCCTATCAGCACCCGGAGTATGACTTCTTCTGGCAGTGGGAGATGGATATACGCTAC
ACTGGCCACTATCACGACCTACTGAGCAAGATCGAGGACTGGGCCAAGGAACAGCCGAGGAAGGGCCTCTGGGAG
CGCAATTCGCGCTTTTACTTTCCCTCCGTTCACGGCTCATGGGACGACTTTTCGCAGATGACACGCGTGCAGACG
GAGATGAGCGCGAGCGGGTTGGACAACGACAAGGTCCTCGGCAAGGTGGGCAGTGCAGCCAAGAAAGCATCCGAG
CTAGTGAGCAACAAAGGCAAGCCGGTATGGGGTCCCCTTCGACCCTCGGATGCCAATGACTGGTTCGAGACGGAG
GAGGACGGCATGCCCGAGACGGAATACGAAGCCGATCGCTACCAGTGGGGCGTGGGCGAAGAAGCCGACTACATC
TCGCTGAACCCCCTCTTCGATCCGGAGGGCACAACCTGGCTGCTCAAGGACGACATCACGGGCTTCAACGGGTCG
CATCCGCTGCCCCCTCGCCGAGCATCCATCATCACGACGGCTCGCATGTCGCGCCGGCTGCTCATGGCCATGCAC
CGGACGACGGCGTACAAGAAGCAGTTTGCCTTTCCCGAGATGTGGCCGGCGACGGTAGCCCTCCACCACGGCTTC
AAGTCGGTCTTTGCGCCTCACCCCATGTACGTCGACAGGAAGTGGCCGGTCAAGTACATGGCGCAGGTCTACAAC
GGCGGCCGAGACGGCACAAGCGGAGGCTCGCGGACGAGCATCTTCGGCGAGCGCGAGCACAACATGCACGGCATC
ACCTGGTTCTACAACTCGGGCTTCGCGCCCAACCTGTACCGTCGCTGGCTCGGCCTCAAGGTCAACAACGACGGC
GGCCCCGACTTTGAGACGACGACGGATGCCTCCAAGCAGGGCAAAGGAGGCGGCGGCGTTGGTGCCATGCCCGGC
GGTGAGGGCCGTATGTGTCTGCCGCCCATGCTGCTGCATCCCGTCAAGGATGTGGAGCAGCCGGTCGAGGACGTT
GCGGTCACAGAGGGCGAGCTGCCCATCACGGATCCAGCAGCGTGA
Gene >Ophio5|2939
ATGGGGGCTGTCTCAAACCCTCTGCGCTCTCGCGAGCATCGGCTGCCGCTGTACCAGAAGATCGACCCGTCTACC
AAGGATAGATATTCAGACGACGGCTTCGAGTCGCCCATATCCGACACCGAGTCCGATCATACGCTCGCTACTGTG
TCGCCTTGCCGATCTCGCGATATCTCCCACTCGGTCTCCAAGGGCCACTTTCTGCTGTCGAGGCGCCGGCCCGTC
CTCTCTACCCGCAAGGCCGGCCTTTATCCCTATCGCCTGCCCGCCAGGGTTTCGCGCTATGTCTTCCTTGGCGTG
CTGGGCATCCTCGTCCTCATGATACTCAGCCTGATACGCGCCAGTCAGGTCGAAAACTGGAAAGTGGTCAATGGC
AAGGTCAGCTTGGCGCCCGCGCCCGCGCCCGTCTGGGAGCAGTTCCCCTTCCTCGAGAGATACTACGGCGGTCTG
CGGCACTTGAAGCCCTTTCATGAGAGCGAGCCCGAATATCCGCGCCCGGCTGAGTCTCGAACTCCGCCGTCGTCT
CGGGGGCGCATTACGGCGCGAGCGGACATTCCCCTGAGCAAGTCTTGGCAGCACTTCCCTGGGAGGAGCACCGAG
TCGGGCATCCAAGAGTGTTTCCTTGATGCCGCTGGCAACATACGGCCCCCCCCTCTACGCTACTACGAGGGGCGC
CCCCTCGGCTTTCCGGAAAATGTGGCCGGCTCCTACGAGGTGCTGAAATTGCCGCAAGACATCTGCTTTGAGCGC
TTCGGCCGGCTCGGCCCGTACGGCTTGGGGTACTCCGCCCGCGCTGGTGGCCTGGGCACGAGCGAGTACGGCGAC
AAGGAAGGGTCTGAGGCGGTATGGGACAAGACACGGCCTGTCGACTTTCGCCACGTCGATTGGGCCCACGTCCAG
CGCCAATGCTTCAATGCGAATGCCGGACGCTTCCGTGAGCTGCCGGTGTCGACGCCGGCGCCGCATGGCTTCTAC
GTGGCGAATTCTCGGTCCTCGAGCATCCGACACCGAAATGTCGTTTCCAACGGTTCCAGCGGCCACGCCAATGCC
CCGAGAAGCGACGAGGCGGACGGCAAAATCGAGAAACAAGCCAGGACGGCCGTCGTCGTCCGATGCTGGGACGAG
TACTTGTTCCGCGAGGACGACATCGCCAATATGCGAGCCATGATCACTGAACTATCCCTGGCATCGGGTGGACGG
TACGACGTGCATCTGCTCGTGCAAGTCAAGAACGACGCCCACAACCCCATCTGGGCAGATCATGAAGCCTATGAG
AAGCGGATCCGCGATAGCGTGCCTGAGGAGTTTCGAGGATTGGTCACGCTCTGGACCGAGACGCAGATGTTGTCG
CTTTACCAGGGCATCTACGACTTGTGGAGTCGGGGCCCCGGGCTGCCCGTTCACGGCGTCTATCGAGGATTGTCG
ATGGCGATGCAGTATTTCGCCTATCAGCACCCGGAGTATGACTTCTTCTGGCAGTGGGAGATGGATATACGCTAC
ACTGGCCACTATCACGACCTACTGAGCAAGATCGAGGACTGGGCCAAGGAACAGCCGAGGAAGGGCCTCTGGGAG
CGCAATTCGCGCTTTTACTTTCCCTCCGTTCACGGCTCATGGGACGACTTTTCGCAGATGACACGCGTGCAGACG
GAGATGAGCGCGAGCGGGTTGGACAACGACAAGGTCCTCGGCAAGGTGGGCAGTGCAGCCAAGAAAGCATCCGAG
CTAGTGAGCAACAAAGGCAAGCCGGTATGGGGTCCCCTTCGACCCTCGGATGCCAATGACTGGTTCGAGACGGAG
GAGGACGGCATGCCCGAGACGGAATACGAAGCCGATCGCTACCAGTGGGGCGTGGGCGAAGAAGCCGACTACATC
TCGCTGAACCCCCTCTTCGATCCGGAGGGCACAACCTGGCTGCTCAAGGACGACATCACGGGCTTCAACGGGTCG
CATCCGCTGCCCCCTCGCCGAGCATCCATCATCACGACGGCTCGCATGTCGCGCCGGCTGCTCATGGCCATGCAC
CGGACGACGGCGTACAAGAAGCAGTTTGCCTTTCCCGAGATGTGGCCGGCGACGGTAGCCCTCCACCACGGCTTC
AAGTCGGTCTTTGCGCCTCACCCCATGTACGTCGACAGGAAGTGGCCGGTCAAGTACATGGCGCAGGTCTACAAC
GGCGGCCGAGACGGCACAAGCGGAGGCTCGCGGACGAGCATCTTCGGCGAGCGCGAGCACAACATGCACGGCATC
ACCTGGTTCTACAACTCGGGCTTCGCGCCCAACCTGTACCGTCGCTGGCTCGGCCTCAAGGTCAACAACGACGGC
GGCCCCGACTTTGAGACGACGACGGATGCCTCCAAGCAGGGCAAAGGAGGCGGCGGCGTTGGTGCCATGCCCGGC
GGTGAGGGCCGTATGTGTCTGCCGCCCATGCTGCTGCATCCCGTCAAGGATGTGGAGCAGCCGGTCGAGGACGTT
GCGGTCACAGAGGGCGAGCTGCCCATCACGGATCCAGCAGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail