Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2932
Gene name
Locationscaffold_234:2570..5992
Strand-
Gene length (bp)3422
Transcript length (bp)3180
Coding sequence length (bp)3177
Protein length (aa) 1059

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00916 Sulfate_transp Sulfate permease family 3.2E-56 267 662
PF00027 cNMP_binding Cyclic nucleotide-binding domain 2.1E-15 942 1024
PF01740 STAS STAS domain 2.2E-09 725 831

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09764|YA7B_SCHPO Uncharacterized protein C24H6.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.11c PE=3 SV=1 267 1057 0.0E+00
sp|P53273|YG35_YEAST Uncharacterized vacuolar membrane protein YGR125W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR125W PE=1 SV=1 249 1058 0.0E+00

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0008272 sulfate transport Yes
GO:0015116 sulfate transmembrane transporter activity Yes
GO:1901682 sulfur compound transmembrane transporter activity No
GO:0008150 biological_process No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0072348 sulfur compound transport No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0008509 anion transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0006820 anion transport No
GO:0005575 cellular_component No
GO:0015698 inorganic anion transport No
GO:0006811 ion transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

Domain # Start End Length
1 254 276 22
2 296 318 22
3 357 379 22
4 391 413 22
5 433 455 22
6 464 486 22
7 518 540 22
8 602 624 22
9 628 647 19
10 660 682 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 20.10 10.84 29.37
CcL In ants, during behavior modification 86.11 40.69 131.54
CcD In ants, recently dead 45.52 24.02 67.03

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.008271 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2932
MSSSPSLPPSRLGPASTSPLDEASLPPASARLLSSSAGSPKGFREPIRSYIHASARLLLVPVDSEQNARSVREDT
AELASYLLSDGSTRRRPSFLQRGSLDLFDAAERMEEDARPDDTIVEVLEPPSPVVDGSREDDAGPSMLSNLLRRS
PPDSFVPDAPIASEARNSAPKRPQPNVLQADPRRQVVVATEETPLLDDAAFPDRFSDSPDIEGLKLSHGKTWFGK
LTGRTRRVQGRALHAFAVAFNPRRWDRRAIWQNVFLGPVSCLPAVIVGLLLNILDALSYGMILFPLGKPLFAHLG
SAGLSMYYVSTIVSQFVFSSGSVFKGAIGSELIEVVPFFHNMALKIMDSVGPENADAVIATTIVAYAASSMMTGL
VFYLMGKFKFGFLVGFIPRHILIGCIGGVGWFLIATGFEVSARLDGSLDYNLDTLIKLTQSDTVLLWMFPLILSI
MLFYGQSRVRSKYFLPLYIIAIPLVFYFFVVSLDGLEVDNLRDGGWIFRGSPPDEPWWYFYTLYRFDLVHWSAVV
EVIPAMLALTFFGILHVPINVPALALNCGEDNADLDRELKLHGYSNLLSGCLGSIQNYLVYANTVFFIRSGGDRR
LAGFMLAVLTFGVMMIGPSIIGFIPIMMVATLIFDLGFELLLEAVWLPRKKLKLAEYLTVIAIVLIMGIYDFVIG
IGVGILLAFVSLTIQTSRVSAIRGTYGGDIVTSTVRRNPFHSQYLHQVGQQIYIIKLTGYLFFGTVVSVEEEIRG
ILDDKTFAKKPIKFLILDMCHVTGLDYSAGEAFNTISRLLHVKSVFLVLSGVDAESQLGRNLRAVGLGMDEIEVL
MLPTLNSALESCENELLKTLYARQRELSLTKKTATASLDVPVGPTTPAASPFDPLLNSPRRNHLAQAAREALTHA
EGERPQRWQSFKEPLRLMLQVFQGLSDKNEDFWFPARSYFKRRDYSSGTVLFCRGEAADGFYLVESGILRAEYDL
PQGWLYESIVAGTTCGELPFFSETERTATVQVDRDCVVWVMDREGWVKLQRNKPEVARELLKMSLKLTSERMSAI
TSHILAMAG
Coding >Ophio5|2932
ATGTCATCGTCGCCTTCCCTCCCACCCAGCCGCCTCGGCCCGGCCAGCACTAGCCCCTTGGACGAAGCCTCGTTA
CCACCGGCCTCGGCCCGCCTGTTGTCGTCCTCGGCCGGTTCGCCCAAGGGGTTCCGAGAGCCTATCCGGTCGTAC
ATCCATGCCTCGGCTCGCCTGCTGCTGGTGCCCGTCGATAGCGAGCAGAATGCCCGCTCCGTTCGCGAGGACACA
GCCGAACTAGCAAGTTACCTTTTGTCGGATGGCTCAACTCGTCGGAGGCCCTCTTTCTTGCAACGAGGGAGTCTG
GATCTGTTCGACGCCGCCGAGCGCATGGAGGAAGACGCGCGTCCAGACGACACCATCGTCGAGGTGCTGGAGCCG
CCGTCGCCCGTCGTCGACGGTTCGAGAGAGGACGATGCCGGGCCGTCGATGCTGTCTAACCTCCTTAGAAGATCC
CCGCCTGACTCGTTCGTTCCCGACGCGCCAATCGCAAGCGAGGCTCGAAACAGCGCCCCCAAGCGACCGCAGCCA
AACGTTCTGCAGGCAGATCCACGACGCCAAGTGGTGGTTGCGACGGAAGAAACACCTCTGCTGGACGACGCGGCG
TTCCCAGACAGGTTTAGCGATTCGCCAGATATCGAGGGATTGAAACTATCCCACGGGAAAACATGGTTCGGCAAG
CTTACTGGGCGCACCCGTCGCGTCCAAGGTCGTGCTCTCCATGCCTTCGCCGTGGCTTTCAATCCTCGTCGTTGG
GATCGAAGAGCTATATGGCAGAATGTGTTTCTGGGCCCGGTCTCTTGCCTTCCTGCCGTCATTGTCGGCCTTCTT
CTCAATATTCTAGACGCTCTTTCCTACGGCATGATATTATTTCCTCTCGGAAAGCCGCTCTTTGCTCATCTGGGC
TCAGCAGGCCTCTCCATGTACTATGTCAGCACCATCGTCTCTCAGTTTGTCTTCTCCTCTGGAAGCGTTTTCAAA
GGGGCCATCGGATCAGAGCTGATCGAGGTCGTTCCCTTCTTTCATAACATGGCTCTCAAGATCATGGACAGCGTC
GGTCCAGAAAACGCCGATGCCGTGATTGCGACTACCATCGTGGCCTATGCCGCAAGCTCGATGATGACGGGTCTG
GTCTTTTATCTTATGGGCAAGTTCAAGTTCGGTTTCTTGGTCGGCTTCATCCCCAGGCACATCTTGATCGGATGC
ATCGGTGGAGTCGGCTGGTTCCTGATCGCCACTGGATTCGAGGTCTCTGCCCGCCTCGACGGGAGCCTCGACTAT
AACCTCGACACGCTAATCAAGCTCACCCAGTCCGACACCGTCTTGCTGTGGATGTTTCCTCTCATTCTGTCAATC
ATGCTCTTCTATGGCCAGTCGCGGGTTCGATCCAAGTATTTCCTGCCGCTCTACATCATCGCAATACCACTAGTC
TTTTACTTCTTCGTCGTGTCCCTTGACGGCCTGGAAGTCGATAACTTGCGCGACGGCGGTTGGATATTTCGAGGT
TCGCCACCGGACGAGCCATGGTGGTACTTTTACACCCTTTATCGATTTGACCTGGTACACTGGAGCGCCGTCGTC
GAAGTGATTCCCGCCATGCTGGCACTGACTTTCTTCGGTATTCTTCACGTTCCGATCAATGTGCCTGCGTTGGCA
CTCAACTGTGGCGAGGACAACGCGGATCTGGACAGGGAGCTGAAGCTCCACGGGTATTCCAACCTTTTGTCTGGG
TGCCTGGGCAGCATCCAAAACTACCTGGTGTATGCAAACACCGTCTTCTTCATCCGTTCGGGCGGCGACAGACGC
CTTGCCGGCTTCATGCTGGCCGTTCTCACGTTTGGCGTCATGATGATTGGTCCTTCCATCATCGGCTTCATCCCC
ATCATGATGGTCGCCACACTCATCTTTGACCTCGGCTTCGAGCTGCTCCTCGAGGCCGTGTGGCTTCCGCGCAAA
AAGCTCAAGCTAGCCGAATACCTCACCGTCATCGCCATCGTCCTGATTATGGGAATTTACGATTTTGTCATCGGC
ATCGGCGTGGGCATTCTGCTGGCCTTTGTCTCTCTCACCATCCAGACGTCCCGTGTGTCGGCAATCAGGGGTACC
TATGGCGGTGACATCGTCACGTCCACGGTCCGTCGCAACCCGTTCCATAGCCAGTATCTACACCAAGTCGGCCAG
CAGATCTACATCATCAAGCTTACGGGATACCTCTTCTTCGGCACCGTCGTCAGTGTCGAGGAGGAGATACGGGGC
ATCTTGGACGACAAGACGTTCGCAAAGAAGCCCATCAAGTTCCTCATCCTGGACATGTGTCATGTAACCGGCCTG
GATTACTCGGCGGGCGAGGCCTTCAACACAATCAGCCGGCTTCTGCATGTCAAGAGCGTTTTCCTCGTCCTCAGC
GGCGTCGATGCCGAGAGCCAGCTTGGGCGGAATCTTCGGGCCGTGGGCCTCGGGATGGACGAGATCGAGGTACTG
ATGCTGCCGACGCTCAACTCGGCGCTCGAGAGCTGCGAAAACGAGCTGCTCAAGACGCTGTATGCCAGGCAGCGC
GAGCTGAGCTTGACGAAGAAGACGGCGACGGCGAGCCTTGACGTTCCCGTGGGCCCAACAACGCCGGCAGCCTCC
CCGTTCGACCCGCTTCTCAATTCGCCTCGACGAAATCACTTGGCACAGGCGGCGCGCGAGGCCCTCACCCACGCC
GAGGGCGAGCGACCGCAAAGGTGGCAGAGTTTTAAGGAGCCGCTGCGCCTGATGCTGCAGGTGTTCCAGGGGCTG
AGCGACAAGAACGAAGACTTTTGGTTCCCGGCGCGATCCTACTTTAAGCGGCGGGATTACAGCTCGGGGACGGTG
CTCTTCTGCCGAGGCGAGGCGGCCGACGGCTTCTACCTCGTCGAGAGCGGCATCCTCCGGGCCGAGTATGACCTG
CCTCAGGGATGGCTCTACGAGAGCATCGTGGCGGGCACCACCTGCGGGGAGCTGCCGTTCTTCTCCGAGACGGAG
CGGACGGCGACGGTACAAGTGGACAGGGACTGCGTGGTATGGGTCATGGACCGCGAGGGCTGGGTGAAGCTGCAA
CGGAATAAGCCAGAGGTTGCGCGGGAACTGTTGAAGATGTCGTTGAAGCTGACGAGCGAGCGCATGAGCGCCATC
ACGTCTCATATATTGGCCATGGCGGGA
Transcript >Ophio5|2932
ATGTCATCGTCGCCTTCCCTCCCACCCAGCCGCCTCGGCCCGGCCAGCACTAGCCCCTTGGACGAAGCCTCGTTA
CCACCGGCCTCGGCCCGCCTGTTGTCGTCCTCGGCCGGTTCGCCCAAGGGGTTCCGAGAGCCTATCCGGTCGTAC
ATCCATGCCTCGGCTCGCCTGCTGCTGGTGCCCGTCGATAGCGAGCAGAATGCCCGCTCCGTTCGCGAGGACACA
GCCGAACTAGCAAGTTACCTTTTGTCGGATGGCTCAACTCGTCGGAGGCCCTCTTTCTTGCAACGAGGGAGTCTG
GATCTGTTCGACGCCGCCGAGCGCATGGAGGAAGACGCGCGTCCAGACGACACCATCGTCGAGGTGCTGGAGCCG
CCGTCGCCCGTCGTCGACGGTTCGAGAGAGGACGATGCCGGGCCGTCGATGCTGTCTAACCTCCTTAGAAGATCC
CCGCCTGACTCGTTCGTTCCCGACGCGCCAATCGCAAGCGAGGCTCGAAACAGCGCCCCCAAGCGACCGCAGCCA
AACGTTCTGCAGGCAGATCCACGACGCCAAGTGGTGGTTGCGACGGAAGAAACACCTCTGCTGGACGACGCGGCG
TTCCCAGACAGGTTTAGCGATTCGCCAGATATCGAGGGATTGAAACTATCCCACGGGAAAACATGGTTCGGCAAG
CTTACTGGGCGCACCCGTCGCGTCCAAGGTCGTGCTCTCCATGCCTTCGCCGTGGCTTTCAATCCTCGTCGTTGG
GATCGAAGAGCTATATGGCAGAATGTGTTTCTGGGCCCGGTCTCTTGCCTTCCTGCCGTCATTGTCGGCCTTCTT
CTCAATATTCTAGACGCTCTTTCCTACGGCATGATATTATTTCCTCTCGGAAAGCCGCTCTTTGCTCATCTGGGC
TCAGCAGGCCTCTCCATGTACTATGTCAGCACCATCGTCTCTCAGTTTGTCTTCTCCTCTGGAAGCGTTTTCAAA
GGGGCCATCGGATCAGAGCTGATCGAGGTCGTTCCCTTCTTTCATAACATGGCTCTCAAGATCATGGACAGCGTC
GGTCCAGAAAACGCCGATGCCGTGATTGCGACTACCATCGTGGCCTATGCCGCAAGCTCGATGATGACGGGTCTG
GTCTTTTATCTTATGGGCAAGTTCAAGTTCGGTTTCTTGGTCGGCTTCATCCCCAGGCACATCTTGATCGGATGC
ATCGGTGGAGTCGGCTGGTTCCTGATCGCCACTGGATTCGAGGTCTCTGCCCGCCTCGACGGGAGCCTCGACTAT
AACCTCGACACGCTAATCAAGCTCACCCAGTCCGACACCGTCTTGCTGTGGATGTTTCCTCTCATTCTGTCAATC
ATGCTCTTCTATGGCCAGTCGCGGGTTCGATCCAAGTATTTCCTGCCGCTCTACATCATCGCAATACCACTAGTC
TTTTACTTCTTCGTCGTGTCCCTTGACGGCCTGGAAGTCGATAACTTGCGCGACGGCGGTTGGATATTTCGAGGT
TCGCCACCGGACGAGCCATGGTGGTACTTTTACACCCTTTATCGATTTGACCTGGTACACTGGAGCGCCGTCGTC
GAAGTGATTCCCGCCATGCTGGCACTGACTTTCTTCGGTATTCTTCACGTTCCGATCAATGTGCCTGCGTTGGCA
CTCAACTGTGGCGAGGACAACGCGGATCTGGACAGGGAGCTGAAGCTCCACGGGTATTCCAACCTTTTGTCTGGG
TGCCTGGGCAGCATCCAAAACTACCTGGTGTATGCAAACACCGTCTTCTTCATCCGTTCGGGCGGCGACAGACGC
CTTGCCGGCTTCATGCTGGCCGTTCTCACGTTTGGCGTCATGATGATTGGTCCTTCCATCATCGGCTTCATCCCC
ATCATGATGGTCGCCACACTCATCTTTGACCTCGGCTTCGAGCTGCTCCTCGAGGCCGTGTGGCTTCCGCGCAAA
AAGCTCAAGCTAGCCGAATACCTCACCGTCATCGCCATCGTCCTGATTATGGGAATTTACGATTTTGTCATCGGC
ATCGGCGTGGGCATTCTGCTGGCCTTTGTCTCTCTCACCATCCAGACGTCCCGTGTGTCGGCAATCAGGGGTACC
TATGGCGGTGACATCGTCACGTCCACGGTCCGTCGCAACCCGTTCCATAGCCAGTATCTACACCAAGTCGGCCAG
CAGATCTACATCATCAAGCTTACGGGATACCTCTTCTTCGGCACCGTCGTCAGTGTCGAGGAGGAGATACGGGGC
ATCTTGGACGACAAGACGTTCGCAAAGAAGCCCATCAAGTTCCTCATCCTGGACATGTGTCATGTAACCGGCCTG
GATTACTCGGCGGGCGAGGCCTTCAACACAATCAGCCGGCTTCTGCATGTCAAGAGCGTTTTCCTCGTCCTCAGC
GGCGTCGATGCCGAGAGCCAGCTTGGGCGGAATCTTCGGGCCGTGGGCCTCGGGATGGACGAGATCGAGGTACTG
ATGCTGCCGACGCTCAACTCGGCGCTCGAGAGCTGCGAAAACGAGCTGCTCAAGACGCTGTATGCCAGGCAGCGC
GAGCTGAGCTTGACGAAGAAGACGGCGACGGCGAGCCTTGACGTTCCCGTGGGCCCAACAACGCCGGCAGCCTCC
CCGTTCGACCCGCTTCTCAATTCGCCTCGACGAAATCACTTGGCACAGGCGGCGCGCGAGGCCCTCACCCACGCC
GAGGGCGAGCGACCGCAAAGGTGGCAGAGTTTTAAGGAGCCGCTGCGCCTGATGCTGCAGGTGTTCCAGGGGCTG
AGCGACAAGAACGAAGACTTTTGGTTCCCGGCGCGATCCTACTTTAAGCGGCGGGATTACAGCTCGGGGACGGTG
CTCTTCTGCCGAGGCGAGGCGGCCGACGGCTTCTACCTCGTCGAGAGCGGCATCCTCCGGGCCGAGTATGACCTG
CCTCAGGGATGGCTCTACGAGAGCATCGTGGCGGGCACCACCTGCGGGGAGCTGCCGTTCTTCTCCGAGACGGAG
CGGACGGCGACGGTACAAGTGGACAGGGACTGCGTGGTATGGGTCATGGACCGCGAGGGCTGGGTGAAGCTGCAA
CGGAATAAGCCAGAGGTTGCGCGGGAACTGTTGAAGATGTCGTTGAAGCTGACGAGCGAGCGCATGAGCGCCATC
ACGTCTCATATATTGGCCATGGCGGGATGA
Gene >Ophio5|2932
ATGTCATCGTCGCCTTCCCTCCCACCCAGCCGCCTCGGCCCGGCCAGCACTAGCCCCTTGGACGAAGCCTCGTTA
CCACCGGCCTCGGCCCGCCTGTTGTCGTCCTCGGCCGGTTCGCCCAAGGGGTTCCGAGAGCCTATCCGGTCGTAC
ATCCATGCCTCGGCTCGCCTGCTGCTGGGTGAGTTGCCTCAGCCTTTCCCGCGCCCGCAACCCACGGACTGACCG
GCCATAGTGCCCGTCGATAGCGAGCAGAATGCCCGCTCCGTTCGCGAGGACACAGCCGAACTAGCAAGTTACCTT
TTGTCGGATGGCTCAACTCGTCGGAGGCCCTCTTTCTTGCAACGAGGGAGTCTGGATCTGTTCGACGCCGCCGAG
CGCATGGAGGAAGACGCGCGTCCAGACGACACCATCGTCGAGGTGCTGGAGCCGCCGTCGCCCGTCGTCGACGGT
TCGAGAGAGGACGATGCCGGGCCGTCGATGCTGTCTAACCTCCTTAGAAGATCCCCGCCTGACTCGTTCGTTCCC
GACGCGCCAATCGCAAGCGAGGCTCGAAACAGCGCCCCCAAGCGACCGCAGCCAAACGTTCTGCAGGCAGATCCA
CGACGCCAAGTGGTGGTTGCGACGGAAGAAACACCTCTGCTGGACGACGCGGCGTTCCCAGACAGGTTTAGCGAT
TCGCCAGATATCGAGGGATTGAAACTATCCCACGGGAAAACATGGTTCGGCAAGCTTACTGGGCGCACCCGTCGC
GTCCAAGGTCGTGCTCTCCATGCCTTCGCCGTGGCTTTCAATCCTCGTCGTTGGGATCGAAGAGCTATATGGCAG
AATGTGTTTCTGGGCCCGGTCTCTTGCCTTCCTGCCGTCATTGTCGGCCTTCTTCTCAATATTCTAGACGCTCTT
TCCTACGGTGCGTCCCTCCCCAACGGTTCAGATGACACTATCCCTGAGCTGGCAAGCTGACTCTGCGCAGGCATG
ATATTATTTCCTCTCGGAAAGCCGCTCTTTGCTCATCTGGGCTCAGCAGGCCTCTCCATGTACTATGTCAGCACC
ATCGTCTCTCAGTTTGTCTTCTCCTCTGGAAGCGTTTTCAAAGGGGCCATCGGATCAGAGCTGGTACGAATGAAA
TCCCCCCCCCCCCTTTTTGCTTGGACCCAACAAGTTGCTCACATGGGCGCGTGCAGATCGAGGTCGTTCCCTTCT
TTCATAACATGGCTCTCAAGATCATGGACAGCGTCGGTCCAGAAAACGCCGATGCCGTGATTGCGACTACCATCG
TGGCCTATGCCGCAAGCTCGATGATGACGGGTCTGGTCTTTTATCTTATGGGCAAGTTCAAGTTCGGTTTCTTGG
TCGGCTTCATCCCCAGGCACATCTTGATCGGATGCATCGGTGGAGTCGGCTGGTTCCTGATCGCCACTGGATTCG
AGGTCTCTGCCCGCCTCGACGGGAGCCTCGACTATAACCTCGACACGCTAATCAAGCTCACCCAGTCCGACACCG
TCTTGCTGTGGATGTTTCCTCTCATTCTGTCAATCATGCTCTTCTATGGCCAGTCGCGGGTTCGATCCAAGTATT
TCCTGCCGCTCTACATCATCGCAATACCACTAGTCTTTTACTTCTTCGTCGTGTCCCTTGACGGCCTGGAAGTCG
ATAACTTGCGCGACGGCGGTTGGATATTTCGAGGTTCGCCACCGGACGAGCCATGGTGGTACTTTTACACCCTTT
ATCGTGAGCCGATGCCTGTCTCCCAAACGTCGCGGAATGGCGTTGCTGACGAACCGACAGGATTTGACCTGGTAC
ACTGGAGCGCCGTCGTCGAAGTGATTCCCGCCATGCTGGCACTGACTTTCTTCGGTATTCTTCACGTTCCGATCA
ATGTGCCTGCGTTGGCACTCAACTGTGGCGAGGACAACGCGGATCTGGACAGGGAGCTGAAGCTCCACGGGTATT
CCAACCTTTTGTCTGGGTGCCTGGGCAGCATCCAAAACTACCTGGTGTATGCAAACACCGTCTTCTTCATCCGTT
CGGGCGGCGACAGACGCCTTGCCGGCTTCATGCTGGCCGTTCTCACGTTTGGCGTCATGATGATTGGTCCTTCCA
TCATCGGCTTCATCCCCATCATGATGGTCGCCACACTCATCTTTGACCTCGGCTTCGAGCTGCTCCTCGAGGCCG
TGTGGCTTCCGCGCAAAAAGCTCAAGCTAGCCGAATACCTCACCGTCATCGCCATCGTCCTGATTATGGGAATTT
ACGATTTTGTCATCGGCATCGGCGTGGGCATTCTGCTGGCCTTTGTCTCTCTCACCATCCAGACGTCCCGTGTGT
CGGCAATCAGGGGTACCTATGGCGGTGACATCGTCACGTCCACGGTCCGTCGCAACCCGTTCCATAGCCAGTATC
TACACCAAGTCGGCCAGCAGATCTACATCATCAAGCTTACGGGATACCTCTTCTTCGGCACCGTCGTCAGTGTCG
AGGAGGAGATACGGGGCATCTTGGACGACAAGACGTTCGCAAAGAAGCCCATCAAGTTCCTCATCCTGGACATGT
GTCATGTAACCGGCCTGGATTACTCGGCGGGCGAGGCCTTCAACACAATCAGCCGGCTTCTGCATGTCAAGAGCG
TTTTCCTCGTCCTCAGCGGCGTCGATGCCGAGAGCCAGCTTGGGCGGAATCTTCGGGCCGTGGGCCTCGGGATGG
ACGAGATCGAGGTACTGATGCTGCCGACGCTCAACTCGGCGCTCGAGAGCTGCGAAAACGAGCTGCTCAAGACGC
TGTATGCCAGGCAGCGCGAGCTGAGCTTGACGAAGAAGACGGCGACGGCGAGCCTTGACGTTCCCGTGGGCCCAA
CAACGCCGGCAGCCTCCCCGTTCGACCCGCTTCTCAATTCGCCTCGACGAAATCACTTGGCACAGGCGGCGCGCG
AGGCCCTCACCCACGCCGAGGGCGAGCGACCGCAAAGGTGGCAGAGTTTTAAGGAGCCGCTGCGCCTGATGCTGC
AGGTGTTCCAGGGGCTGAGCGACAAGAACGAAGACTTTTGGTTCCCGGCGCGATCCTACTTTAAGCGGCGGGATT
ACAGCTCGGGGACGGTGCTCTTCTGCCGAGGCGAGGCGGCCGACGGCTTCTACCTCGTCGAGAGCGGCATCCTCC
GGGCCGAGTATGACCTGCCTCAGGGATGGCTCTACGAGAGCATCGTGGCGGGCACCACCTGCGGGGAGCTGCCGT
TCTTCTCCGAGACGGAGCGGACGGCGACGGTACAAGTGGACAGGGACTGCGTGGTATGGGTCATGGACCGCGAGG
GCTGGGTGAAGCTGCAACGGAATAAGCCAGAGGTTGCGCGGGAACTGTTGAAGATGTCGTTGAAGCTGACGAGCG
AGCGCATGAGCGCCATCACGTCTCATATATTGGCCATGGCGGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail