Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2932
Gene name
Locationscaffold_234:2570..5992
Strand-
Gene length (bp)3422
Transcript length (bp)3180
Coding sequence length (bp)3177
Protein length (aa) 1059

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00916 Sulfate_transp Sulfate permease family 3.2E-56 267 662
PF00027 cNMP_binding Cyclic nucleotide-binding domain 2.1E-15 942 1024
PF01740 STAS STAS domain 2.2E-09 725 831

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09764|YA7B_SCHPO Uncharacterized protein C24H6.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.11c PE=3 SV=1 267 1057 0.0E+00
sp|P53273|YG35_YEAST Uncharacterized vacuolar membrane protein YGR125W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR125W PE=1 SV=1 249 1058 0.0E+00

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0008272 sulfate transport Yes
GO:0015116 sulfate transmembrane transporter activity Yes
GO:1901682 sulfur compound transmembrane transporter activity No
GO:0008150 biological_process No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0072348 sulfur compound transport No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0008509 anion transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0006820 anion transport No
GO:0005575 cellular_component No
GO:0015698 inorganic anion transport No
GO:0006811 ion transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

Domain # Start End Length
1 254 276 22
2 296 318 22
3 357 379 22
4 391 413 22
5 433 455 22
6 464 486 22
7 518 540 22
8 602 624 22
9 628 647 19
10 660 682 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2932
MSSSPSLPPSRLGPASTSPLDEASLPPASARLLSSSAGSPKGFREPIRSYIHASARLLLVPVDSEQNARSVREDT
AELASYLLSDGSTRRRPSFLQRGSLDLFDAAERMEEDARPDDTIVEVLEPPSPVVDGSREDDAGPSMLSNLLRRS
PPDSFVPDAPIASEARNSAPKRPQPNVLQADPRRQVVVATEETPLLDDAAFPDRFSDSPDIEGLKLSHGKTWFGK
LTGRTRRVQGRALHAFAVAFNPRRWDRRAIWQNVFLGPVSCLPAVIVGLLLNILDALSYGMILFPLGKPLFAHLG
SAGLSMYYVSTIVSQFVFSSGSVFKGAIGSELIEVVPFFHNMALKIMDSVGPENADAVIATTIVAYAASSMMTGL
VFYLMGKFKFGFLVGFIPRHILIGCIGGVGWFLIATGFEVSARLDGSLDYNLDTLIKLTQSDTVLLWMFPLILSI
MLFYGQSRVRSKYFLPLYIIAIPLVFYFFVVSLDGLEVDNLRDGGWIFRGSPPDEPWWYFYTLYRFDLVHWSAVV
EVIPAMLALTFFGILHVPINVPALALNCGEDNADLDRELKLHGYSNLLSGCLGSIQNYLVYANTVFFIRSGGDRR
LAGFMLAVLTFGVMMIGPSIIGFIPIMMVATLIFDLGFELLLEAVWLPRKKLKLAEYLTVIAIVLIMGIYDFVIG
IGVGILLAFVSLTIQTSRVSAIRGTYGGDIVTSTVRRNPFHSQYLHQVGQQIYIIKLTGYLFFGTVVSVEEEIRG
ILDDKTFAKKPIKFLILDMCHVTGLDYSAGEAFNTISRLLHVKSVFLVLSGVDAESQLGRNLRAVGLGMDEIEVL
MLPTLNSALESCENELLKTLYARQRELSLTKKTATASLDVPVGPTTPAASPFDPLLNSPRRNHLAQAAREALTHA
EGERPQRWQSFKEPLRLMLQVFQGLSDKNEDFWFPARSYFKRRDYSSGTVLFCRGEAADGFYLVESGILRAEYDL
PQGWLYESIVAGTTCGELPFFSETERTATVQVDRDCVVWVMDREGWVKLQRNKPEVARELLKMSLKLTSERMSAI
TSHILAMAG
Coding >Ophio5|2932
ATGTCATCGTCGCCTTCCCTCCCACCCAGCCGCCTCGGCCCGGCCAGCACTAGCCCCTTGGACGAAGCCTCGTTA
CCACCGGCCTCGGCCCGCCTGTTGTCGTCCTCGGCCGGTTCGCCCAAGGGGTTCCGAGAGCCTATCCGGTCGTAC
ATCCATGCCTCGGCTCGCCTGCTGCTGGTGCCCGTCGATAGCGAGCAGAATGCCCGCTCCGTTCGCGAGGACACA
GCCGAACTAGCAAGTTACCTTTTGTCGGATGGCTCAACTCGTCGGAGGCCCTCTTTCTTGCAACGAGGGAGTCTG
GATCTGTTCGACGCCGCCGAGCGCATGGAGGAAGACGCGCGTCCAGACGACACCATCGTCGAGGTGCTGGAGCCG
CCGTCGCCCGTCGTCGACGGTTCGAGAGAGGACGATGCCGGGCCGTCGATGCTGTCTAACCTCCTTAGAAGATCC
CCGCCTGACTCGTTCGTTCCCGACGCGCCAATCGCAAGCGAGGCTCGAAACAGCGCCCCCAAGCGACCGCAGCCA
AACGTTCTGCAGGCAGATCCACGACGCCAAGTGGTGGTTGCGACGGAAGAAACACCTCTGCTGGACGACGCGGCG
TTCCCAGACAGGTTTAGCGATTCGCCAGATATCGAGGGATTGAAACTATCCCACGGGAAAACATGGTTCGGCAAG
CTTACTGGGCGCACCCGTCGCGTCCAAGGTCGTGCTCTCCATGCCTTCGCCGTGGCTTTCAATCCTCGTCGTTGG
GATCGAAGAGCTATATGGCAGAATGTGTTTCTGGGCCCGGTCTCTTGCCTTCCTGCCGTCATTGTCGGCCTTCTT
CTCAATATTCTAGACGCTCTTTCCTACGGCATGATATTATTTCCTCTCGGAAAGCCGCTCTTTGCTCATCTGGGC
TCAGCAGGCCTCTCCATGTACTATGTCAGCACCATCGTCTCTCAGTTTGTCTTCTCCTCTGGAAGCGTTTTCAAA
GGGGCCATCGGATCAGAGCTGATCGAGGTCGTTCCCTTCTTTCATAACATGGCTCTCAAGATCATGGACAGCGTC
GGTCCAGAAAACGCCGATGCCGTGATTGCGACTACCATCGTGGCCTATGCCGCAAGCTCGATGATGACGGGTCTG
GTCTTTTATCTTATGGGCAAGTTCAAGTTCGGTTTCTTGGTCGGCTTCATCCCCAGGCACATCTTGATCGGATGC
ATCGGTGGAGTCGGCTGGTTCCTGATCGCCACTGGATTCGAGGTCTCTGCCCGCCTCGACGGGAGCCTCGACTAT
AACCTCGACACGCTAATCAAGCTCACCCAGTCCGACACCGTCTTGCTGTGGATGTTTCCTCTCATTCTGTCAATC
ATGCTCTTCTATGGCCAGTCGCGGGTTCGATCCAAGTATTTCCTGCCGCTCTACATCATCGCAATACCACTAGTC
TTTTACTTCTTCGTCGTGTCCCTTGACGGCCTGGAAGTCGATAACTTGCGCGACGGCGGTTGGATATTTCGAGGT
TCGCCACCGGACGAGCCATGGTGGTACTTTTACACCCTTTATCGATTTGACCTGGTACACTGGAGCGCCGTCGTC
GAAGTGATTCCCGCCATGCTGGCACTGACTTTCTTCGGTATTCTTCACGTTCCGATCAATGTGCCTGCGTTGGCA
CTCAACTGTGGCGAGGACAACGCGGATCTGGACAGGGAGCTGAAGCTCCACGGGTATTCCAACCTTTTGTCTGGG
TGCCTGGGCAGCATCCAAAACTACCTGGTGTATGCAAACACCGTCTTCTTCATCCGTTCGGGCGGCGACAGACGC
CTTGCCGGCTTCATGCTGGCCGTTCTCACGTTTGGCGTCATGATGATTGGTCCTTCCATCATCGGCTTCATCCCC
ATCATGATGGTCGCCACACTCATCTTTGACCTCGGCTTCGAGCTGCTCCTCGAGGCCGTGTGGCTTCCGCGCAAA
AAGCTCAAGCTAGCCGAATACCTCACCGTCATCGCCATCGTCCTGATTATGGGAATTTACGATTTTGTCATCGGC
ATCGGCGTGGGCATTCTGCTGGCCTTTGTCTCTCTCACCATCCAGACGTCCCGTGTGTCGGCAATCAGGGGTACC
TATGGCGGTGACATCGTCACGTCCACGGTCCGTCGCAACCCGTTCCATAGCCAGTATCTACACCAAGTCGGCCAG
CAGATCTACATCATCAAGCTTACGGGATACCTCTTCTTCGGCACCGTCGTCAGTGTCGAGGAGGAGATACGGGGC
ATCTTGGACGACAAGACGTTCGCAAAGAAGCCCATCAAGTTCCTCATCCTGGACATGTGTCATGTAACCGGCCTG
GATTACTCGGCGGGCGAGGCCTTCAACACAATCAGCCGGCTTCTGCATGTCAAGAGCGTTTTCCTCGTCCTCAGC
GGCGTCGATGCCGAGAGCCAGCTTGGGCGGAATCTTCGGGCCGTGGGCCTCGGGATGGACGAGATCGAGGTACTG
ATGCTGCCGACGCTCAACTCGGCGCTCGAGAGCTGCGAAAACGAGCTGCTCAAGACGCTGTATGCCAGGCAGCGC
GAGCTGAGCTTGACGAAGAAGACGGCGACGGCGAGCCTTGACGTTCCCGTGGGCCCAACAACGCCGGCAGCCTCC
CCGTTCGACCCGCTTCTCAATTCGCCTCGACGAAATCACTTGGCACAGGCGGCGCGCGAGGCCCTCACCCACGCC
GAGGGCGAGCGACCGCAAAGGTGGCAGAGTTTTAAGGAGCCGCTGCGCCTGATGCTGCAGGTGTTCCAGGGGCTG
AGCGACAAGAACGAAGACTTTTGGTTCCCGGCGCGATCCTACTTTAAGCGGCGGGATTACAGCTCGGGGACGGTG
CTCTTCTGCCGAGGCGAGGCGGCCGACGGCTTCTACCTCGTCGAGAGCGGCATCCTCCGGGCCGAGTATGACCTG
CCTCAGGGATGGCTCTACGAGAGCATCGTGGCGGGCACCACCTGCGGGGAGCTGCCGTTCTTCTCCGAGACGGAG
CGGACGGCGACGGTACAAGTGGACAGGGACTGCGTGGTATGGGTCATGGACCGCGAGGGCTGGGTGAAGCTGCAA
CGGAATAAGCCAGAGGTTGCGCGGGAACTGTTGAAGATGTCGTTGAAGCTGACGAGCGAGCGCATGAGCGCCATC
ACGTCTCATATATTGGCCATGGCGGGA
Transcript >Ophio5|2932
ATGTCATCGTCGCCTTCCCTCCCACCCAGCCGCCTCGGCCCGGCCAGCACTAGCCCCTTGGACGAAGCCTCGTTA
CCACCGGCCTCGGCCCGCCTGTTGTCGTCCTCGGCCGGTTCGCCCAAGGGGTTCCGAGAGCCTATCCGGTCGTAC
ATCCATGCCTCGGCTCGCCTGCTGCTGGTGCCCGTCGATAGCGAGCAGAATGCCCGCTCCGTTCGCGAGGACACA
GCCGAACTAGCAAGTTACCTTTTGTCGGATGGCTCAACTCGTCGGAGGCCCTCTTTCTTGCAACGAGGGAGTCTG
GATCTGTTCGACGCCGCCGAGCGCATGGAGGAAGACGCGCGTCCAGACGACACCATCGTCGAGGTGCTGGAGCCG
CCGTCGCCCGTCGTCGACGGTTCGAGAGAGGACGATGCCGGGCCGTCGATGCTGTCTAACCTCCTTAGAAGATCC
CCGCCTGACTCGTTCGTTCCCGACGCGCCAATCGCAAGCGAGGCTCGAAACAGCGCCCCCAAGCGACCGCAGCCA
AACGTTCTGCAGGCAGATCCACGACGCCAAGTGGTGGTTGCGACGGAAGAAACACCTCTGCTGGACGACGCGGCG
TTCCCAGACAGGTTTAGCGATTCGCCAGATATCGAGGGATTGAAACTATCCCACGGGAAAACATGGTTCGGCAAG
CTTACTGGGCGCACCCGTCGCGTCCAAGGTCGTGCTCTCCATGCCTTCGCCGTGGCTTTCAATCCTCGTCGTTGG
GATCGAAGAGCTATATGGCAGAATGTGTTTCTGGGCCCGGTCTCTTGCCTTCCTGCCGTCATTGTCGGCCTTCTT
CTCAATATTCTAGACGCTCTTTCCTACGGCATGATATTATTTCCTCTCGGAAAGCCGCTCTTTGCTCATCTGGGC
TCAGCAGGCCTCTCCATGTACTATGTCAGCACCATCGTCTCTCAGTTTGTCTTCTCCTCTGGAAGCGTTTTCAAA
GGGGCCATCGGATCAGAGCTGATCGAGGTCGTTCCCTTCTTTCATAACATGGCTCTCAAGATCATGGACAGCGTC
GGTCCAGAAAACGCCGATGCCGTGATTGCGACTACCATCGTGGCCTATGCCGCAAGCTCGATGATGACGGGTCTG
GTCTTTTATCTTATGGGCAAGTTCAAGTTCGGTTTCTTGGTCGGCTTCATCCCCAGGCACATCTTGATCGGATGC
ATCGGTGGAGTCGGCTGGTTCCTGATCGCCACTGGATTCGAGGTCTCTGCCCGCCTCGACGGGAGCCTCGACTAT
AACCTCGACACGCTAATCAAGCTCACCCAGTCCGACACCGTCTTGCTGTGGATGTTTCCTCTCATTCTGTCAATC
ATGCTCTTCTATGGCCAGTCGCGGGTTCGATCCAAGTATTTCCTGCCGCTCTACATCATCGCAATACCACTAGTC
TTTTACTTCTTCGTCGTGTCCCTTGACGGCCTGGAAGTCGATAACTTGCGCGACGGCGGTTGGATATTTCGAGGT
TCGCCACCGGACGAGCCATGGTGGTACTTTTACACCCTTTATCGATTTGACCTGGTACACTGGAGCGCCGTCGTC
GAAGTGATTCCCGCCATGCTGGCACTGACTTTCTTCGGTATTCTTCACGTTCCGATCAATGTGCCTGCGTTGGCA
CTCAACTGTGGCGAGGACAACGCGGATCTGGACAGGGAGCTGAAGCTCCACGGGTATTCCAACCTTTTGTCTGGG
TGCCTGGGCAGCATCCAAAACTACCTGGTGTATGCAAACACCGTCTTCTTCATCCGTTCGGGCGGCGACAGACGC
CTTGCCGGCTTCATGCTGGCCGTTCTCACGTTTGGCGTCATGATGATTGGTCCTTCCATCATCGGCTTCATCCCC
ATCATGATGGTCGCCACACTCATCTTTGACCTCGGCTTCGAGCTGCTCCTCGAGGCCGTGTGGCTTCCGCGCAAA
AAGCTCAAGCTAGCCGAATACCTCACCGTCATCGCCATCGTCCTGATTATGGGAATTTACGATTTTGTCATCGGC
ATCGGCGTGGGCATTCTGCTGGCCTTTGTCTCTCTCACCATCCAGACGTCCCGTGTGTCGGCAATCAGGGGTACC
TATGGCGGTGACATCGTCACGTCCACGGTCCGTCGCAACCCGTTCCATAGCCAGTATCTACACCAAGTCGGCCAG
CAGATCTACATCATCAAGCTTACGGGATACCTCTTCTTCGGCACCGTCGTCAGTGTCGAGGAGGAGATACGGGGC
ATCTTGGACGACAAGACGTTCGCAAAGAAGCCCATCAAGTTCCTCATCCTGGACATGTGTCATGTAACCGGCCTG
GATTACTCGGCGGGCGAGGCCTTCAACACAATCAGCCGGCTTCTGCATGTCAAGAGCGTTTTCCTCGTCCTCAGC
GGCGTCGATGCCGAGAGCCAGCTTGGGCGGAATCTTCGGGCCGTGGGCCTCGGGATGGACGAGATCGAGGTACTG
ATGCTGCCGACGCTCAACTCGGCGCTCGAGAGCTGCGAAAACGAGCTGCTCAAGACGCTGTATGCCAGGCAGCGC
GAGCTGAGCTTGACGAAGAAGACGGCGACGGCGAGCCTTGACGTTCCCGTGGGCCCAACAACGCCGGCAGCCTCC
CCGTTCGACCCGCTTCTCAATTCGCCTCGACGAAATCACTTGGCACAGGCGGCGCGCGAGGCCCTCACCCACGCC
GAGGGCGAGCGACCGCAAAGGTGGCAGAGTTTTAAGGAGCCGCTGCGCCTGATGCTGCAGGTGTTCCAGGGGCTG
AGCGACAAGAACGAAGACTTTTGGTTCCCGGCGCGATCCTACTTTAAGCGGCGGGATTACAGCTCGGGGACGGTG
CTCTTCTGCCGAGGCGAGGCGGCCGACGGCTTCTACCTCGTCGAGAGCGGCATCCTCCGGGCCGAGTATGACCTG
CCTCAGGGATGGCTCTACGAGAGCATCGTGGCGGGCACCACCTGCGGGGAGCTGCCGTTCTTCTCCGAGACGGAG
CGGACGGCGACGGTACAAGTGGACAGGGACTGCGTGGTATGGGTCATGGACCGCGAGGGCTGGGTGAAGCTGCAA
CGGAATAAGCCAGAGGTTGCGCGGGAACTGTTGAAGATGTCGTTGAAGCTGACGAGCGAGCGCATGAGCGCCATC
ACGTCTCATATATTGGCCATGGCGGGATGA
Gene >Ophio5|2932
ATGTCATCGTCGCCTTCCCTCCCACCCAGCCGCCTCGGCCCGGCCAGCACTAGCCCCTTGGACGAAGCCTCGTTA
CCACCGGCCTCGGCCCGCCTGTTGTCGTCCTCGGCCGGTTCGCCCAAGGGGTTCCGAGAGCCTATCCGGTCGTAC
ATCCATGCCTCGGCTCGCCTGCTGCTGGGTGAGTTGCCTCAGCCTTTCCCGCGCCCGCAACCCACGGACTGACCG
GCCATAGTGCCCGTCGATAGCGAGCAGAATGCCCGCTCCGTTCGCGAGGACACAGCCGAACTAGCAAGTTACCTT
TTGTCGGATGGCTCAACTCGTCGGAGGCCCTCTTTCTTGCAACGAGGGAGTCTGGATCTGTTCGACGCCGCCGAG
CGCATGGAGGAAGACGCGCGTCCAGACGACACCATCGTCGAGGTGCTGGAGCCGCCGTCGCCCGTCGTCGACGGT
TCGAGAGAGGACGATGCCGGGCCGTCGATGCTGTCTAACCTCCTTAGAAGATCCCCGCCTGACTCGTTCGTTCCC
GACGCGCCAATCGCAAGCGAGGCTCGAAACAGCGCCCCCAAGCGACCGCAGCCAAACGTTCTGCAGGCAGATCCA
CGACGCCAAGTGGTGGTTGCGACGGAAGAAACACCTCTGCTGGACGACGCGGCGTTCCCAGACAGGTTTAGCGAT
TCGCCAGATATCGAGGGATTGAAACTATCCCACGGGAAAACATGGTTCGGCAAGCTTACTGGGCGCACCCGTCGC
GTCCAAGGTCGTGCTCTCCATGCCTTCGCCGTGGCTTTCAATCCTCGTCGTTGGGATCGAAGAGCTATATGGCAG
AATGTGTTTCTGGGCCCGGTCTCTTGCCTTCCTGCCGTCATTGTCGGCCTTCTTCTCAATATTCTAGACGCTCTT
TCCTACGGTGCGTCCCTCCCCAACGGTTCAGATGACACTATCCCTGAGCTGGCAAGCTGACTCTGCGCAGGCATG
ATATTATTTCCTCTCGGAAAGCCGCTCTTTGCTCATCTGGGCTCAGCAGGCCTCTCCATGTACTATGTCAGCACC
ATCGTCTCTCAGTTTGTCTTCTCCTCTGGAAGCGTTTTCAAAGGGGCCATCGGATCAGAGCTGGTACGAATGAAA
TCCCCCCCCCCCCTTTTTGCTTGGACCCAACAAGTTGCTCACATGGGCGCGTGCAGATCGAGGTCGTTCCCTTCT
TTCATAACATGGCTCTCAAGATCATGGACAGCGTCGGTCCAGAAAACGCCGATGCCGTGATTGCGACTACCATCG
TGGCCTATGCCGCAAGCTCGATGATGACGGGTCTGGTCTTTTATCTTATGGGCAAGTTCAAGTTCGGTTTCTTGG
TCGGCTTCATCCCCAGGCACATCTTGATCGGATGCATCGGTGGAGTCGGCTGGTTCCTGATCGCCACTGGATTCG
AGGTCTCTGCCCGCCTCGACGGGAGCCTCGACTATAACCTCGACACGCTAATCAAGCTCACCCAGTCCGACACCG
TCTTGCTGTGGATGTTTCCTCTCATTCTGTCAATCATGCTCTTCTATGGCCAGTCGCGGGTTCGATCCAAGTATT
TCCTGCCGCTCTACATCATCGCAATACCACTAGTCTTTTACTTCTTCGTCGTGTCCCTTGACGGCCTGGAAGTCG
ATAACTTGCGCGACGGCGGTTGGATATTTCGAGGTTCGCCACCGGACGAGCCATGGTGGTACTTTTACACCCTTT
ATCGTGAGCCGATGCCTGTCTCCCAAACGTCGCGGAATGGCGTTGCTGACGAACCGACAGGATTTGACCTGGTAC
ACTGGAGCGCCGTCGTCGAAGTGATTCCCGCCATGCTGGCACTGACTTTCTTCGGTATTCTTCACGTTCCGATCA
ATGTGCCTGCGTTGGCACTCAACTGTGGCGAGGACAACGCGGATCTGGACAGGGAGCTGAAGCTCCACGGGTATT
CCAACCTTTTGTCTGGGTGCCTGGGCAGCATCCAAAACTACCTGGTGTATGCAAACACCGTCTTCTTCATCCGTT
CGGGCGGCGACAGACGCCTTGCCGGCTTCATGCTGGCCGTTCTCACGTTTGGCGTCATGATGATTGGTCCTTCCA
TCATCGGCTTCATCCCCATCATGATGGTCGCCACACTCATCTTTGACCTCGGCTTCGAGCTGCTCCTCGAGGCCG
TGTGGCTTCCGCGCAAAAAGCTCAAGCTAGCCGAATACCTCACCGTCATCGCCATCGTCCTGATTATGGGAATTT
ACGATTTTGTCATCGGCATCGGCGTGGGCATTCTGCTGGCCTTTGTCTCTCTCACCATCCAGACGTCCCGTGTGT
CGGCAATCAGGGGTACCTATGGCGGTGACATCGTCACGTCCACGGTCCGTCGCAACCCGTTCCATAGCCAGTATC
TACACCAAGTCGGCCAGCAGATCTACATCATCAAGCTTACGGGATACCTCTTCTTCGGCACCGTCGTCAGTGTCG
AGGAGGAGATACGGGGCATCTTGGACGACAAGACGTTCGCAAAGAAGCCCATCAAGTTCCTCATCCTGGACATGT
GTCATGTAACCGGCCTGGATTACTCGGCGGGCGAGGCCTTCAACACAATCAGCCGGCTTCTGCATGTCAAGAGCG
TTTTCCTCGTCCTCAGCGGCGTCGATGCCGAGAGCCAGCTTGGGCGGAATCTTCGGGCCGTGGGCCTCGGGATGG
ACGAGATCGAGGTACTGATGCTGCCGACGCTCAACTCGGCGCTCGAGAGCTGCGAAAACGAGCTGCTCAAGACGC
TGTATGCCAGGCAGCGCGAGCTGAGCTTGACGAAGAAGACGGCGACGGCGAGCCTTGACGTTCCCGTGGGCCCAA
CAACGCCGGCAGCCTCCCCGTTCGACCCGCTTCTCAATTCGCCTCGACGAAATCACTTGGCACAGGCGGCGCGCG
AGGCCCTCACCCACGCCGAGGGCGAGCGACCGCAAAGGTGGCAGAGTTTTAAGGAGCCGCTGCGCCTGATGCTGC
AGGTGTTCCAGGGGCTGAGCGACAAGAACGAAGACTTTTGGTTCCCGGCGCGATCCTACTTTAAGCGGCGGGATT
ACAGCTCGGGGACGGTGCTCTTCTGCCGAGGCGAGGCGGCCGACGGCTTCTACCTCGTCGAGAGCGGCATCCTCC
GGGCCGAGTATGACCTGCCTCAGGGATGGCTCTACGAGAGCATCGTGGCGGGCACCACCTGCGGGGAGCTGCCGT
TCTTCTCCGAGACGGAGCGGACGGCGACGGTACAAGTGGACAGGGACTGCGTGGTATGGGTCATGGACCGCGAGG
GCTGGGTGAAGCTGCAACGGAATAAGCCAGAGGTTGCGCGGGAACTGTTGAAGATGTCGTTGAAGCTGACGAGCG
AGCGCATGAGCGCCATCACGTCTCATATATTGGCCATGGCGGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail