Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2930
Gene name
Locationscaffold_233:27645..28743
Strand-
Gene length (bp)1098
Transcript length (bp)1029
Coding sequence length (bp)1026
Protein length (aa) 342

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10294 Methyltransf_16 Lysine methyltransferase 2.1E-08 156 278

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q750W3|RKM5_ASHGO Ribosomal lysine N-methyltransferase 5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RKM5 PE=3 SV=1 161 268 4.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 104 126 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2930
MAQLSALLGDEISDADEGKPDFFFGGGGCGGRSRNGYKTIQLTPVRDVSAVRAAAAGVVARPGIRRPKRRIGRGF
CRGEGGDCLPVTGLAGFESRRRHHRSRSVFFFFFFFFFFFFFFFFYFFFFFFFYFSVLMVTPPFASWLASAPAAT
LLSALTARESPAAVLELGCGISPLNAVALRRRVSSFVLSDQEYVQKVLRRNMTAARLDVPEQDAKRQQPRCESAP
VYFRPLDWETDAVTAALCAPARCFDVVLACDCVFNEALLPPFVQTCVDVCRLKRELDDAGPCACIVAQQLRSDIV
FSAWMTLFLEAFHVWRVPDELLPDELRLEAGFVIHVAILRDA
Coding >Ophio5|2930
ATGGCCCAACTAAGCGCCCTCCTCGGCGACGAAATCAGCGACGCGGATGAAGGCAAGCCCGATTTTTTTTTTGGG
GGAGGGGGTTGTGGGGGCCGGTCCAGAAATGGGTATAAAACCATACAGCTGACACCTGTCAGAGACGTTTCTGCT
GTACGCGCAGCAGCCGCTGGCGTCGTCGCGCGACCTGGGATTCGTCGACCGAAGCGCCGAATCGGTCGAGGTTTC
TGTCGCGGGGAGGGAGGTGACTGTTTACCAGTCACAGGGCTTGCTGGCTTCGAATCGCGCCGCCGGCACCACCGG
AGCCGGTCCGTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTACTTCTTCTTCTTC
TTCTTCTTCTACTTCTCGGTTCTCATGGTAACGCCCCCGTTCGCCTCATGGCTCGCCTCCGCCCCGGCAGCGACA
CTGCTCAGCGCCCTCACCGCACGCGAATCGCCTGCCGCCGTCCTCGAACTCGGCTGCGGCATCTCGCCTCTTAAC
GCCGTCGCTCTCCGTCGGCGCGTGTCGAGCTTTGTGCTCTCGGACCAGGAGTATGTGCAGAAAGTACTGCGGCGA
AACATGACGGCCGCCCGTCTTGACGTACCCGAACAGGACGCCAAACGACAACAACCAAGATGCGAAAGTGCCCCT
GTCTACTTCCGTCCGCTGGATTGGGAAACGGATGCTGTGACGGCTGCGTTGTGCGCTCCGGCTCGCTGCTTCGAT
GTCGTCCTGGCTTGTGATTGCGTCTTCAATGAGGCTCTCCTTCCGCCTTTTGTACAGACGTGTGTCGATGTTTGT
CGCTTGAAGCGAGAGCTTGATGATGCTGGCCCTTGCGCTTGTATCGTCGCGCAGCAACTGCGTAGCGATATCGTC
TTTTCCGCTTGGATGACTCTCTTCCTGGAGGCTTTTCACGTATGGCGCGTGCCGGACGAGTTACTGCCGGACGAG
TTGCGCCTCGAGGCTGGCTTCGTTATCCACGTCGCCATCCTTAGGGATGCA
Transcript >Ophio5|2930
ATGGCCCAACTAAGCGCCCTCCTCGGCGACGAAATCAGCGACGCGGATGAAGGCAAGCCCGATTTTTTTTTTGGG
GGAGGGGGTTGTGGGGGCCGGTCCAGAAATGGGTATAAAACCATACAGCTGACACCTGTCAGAGACGTTTCTGCT
GTACGCGCAGCAGCCGCTGGCGTCGTCGCGCGACCTGGGATTCGTCGACCGAAGCGCCGAATCGGTCGAGGTTTC
TGTCGCGGGGAGGGAGGTGACTGTTTACCAGTCACAGGGCTTGCTGGCTTCGAATCGCGCCGCCGGCACCACCGG
AGCCGGTCCGTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTACTTCTTCTTCTTC
TTCTTCTTCTACTTCTCGGTTCTCATGGTAACGCCCCCGTTCGCCTCATGGCTCGCCTCCGCCCCGGCAGCGACA
CTGCTCAGCGCCCTCACCGCACGCGAATCGCCTGCCGCCGTCCTCGAACTCGGCTGCGGCATCTCGCCTCTTAAC
GCCGTCGCTCTCCGTCGGCGCGTGTCGAGCTTTGTGCTCTCGGACCAGGAGTATGTGCAGAAAGTACTGCGGCGA
AACATGACGGCCGCCCGTCTTGACGTACCCGAACAGGACGCCAAACGACAACAACCAAGATGCGAAAGTGCCCCT
GTCTACTTCCGTCCGCTGGATTGGGAAACGGATGCTGTGACGGCTGCGTTGTGCGCTCCGGCTCGCTGCTTCGAT
GTCGTCCTGGCTTGTGATTGCGTCTTCAATGAGGCTCTCCTTCCGCCTTTTGTACAGACGTGTGTCGATGTTTGT
CGCTTGAAGCGAGAGCTTGATGATGCTGGCCCTTGCGCTTGTATCGTCGCGCAGCAACTGCGTAGCGATATCGTC
TTTTCCGCTTGGATGACTCTCTTCCTGGAGGCTTTTCACGTATGGCGCGTGCCGGACGAGTTACTGCCGGACGAG
TTGCGCCTCGAGGCTGGCTTCGTTATCCACGTCGCCATCCTTAGGGATGCATAG
Gene >Ophio5|2930
ATGGCCCAACTAAGCGCCCTCCTCGGCGACGAAATCAGCGACGCGGATGAAGGCAAGCCCGATTTTTTTTTTGGG
GGAGGGGGTTGTGGGGGCCGGTCCAGAAATGGGTATAAAACCATACAGCTGACACCTGTCAGAGACGTTTCTGCT
GTACGCGCAGCAGCCGCTGGCGTCGTCGCGCGACCTGGGATTCGTCGACCGAAGCGCCGAATCGGTCGAGGTTTC
TGTCGCGGGGAGGGAGGTGACTGTTTACCAGTCACAGGGCTTGCTGGCTTCGAATCGCGCCGCCGGCACCACCGG
AGCCGGTCCGTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTACTTCTTCTTCTTC
TTCTTCTTCTACTTCTCGGTTCTCATGTCTCGGGGGGGACTGACGCCATGACGCTCCAACACGGCGGAAAGTCAT
CTCTCGCCAGTTCTTTGGAGGGTAACGCCCCCGTTCGCCTCATGGCTCGCCTCCGCCCCGGCAGCGACACTGCTC
AGCGCCCTCACCGCACGCGAATCGCCTGCCGCCGTCCTCGAACTCGGCTGCGGCATCTCGCCTCTTAACGCCGTC
GCTCTCCGTCGGCGCGTGTCGAGCTTTGTGCTCTCGGACCAGGAGTATGTGCAGAAAGTACTGCGGCGAAACATG
ACGGCCGCCCGTCTTGACGTACCCGAACAGGACGCCAAACGACAACAACCAAGATGCGAAAGTGCCCCTGTCTAC
TTCCGTCCGCTGGATTGGGAAACGGATGCTGTGACGGCTGCGTTGTGCGCTCCGGCTCGCTGCTTCGATGTCGTC
CTGGCTTGTGATTGCGTCTTCAATGAGGCTCTCCTTCCGCCTTTTGTACAGACGTGTGTCGATGTTTGTCGCTTG
AAGCGAGAGCTTGATGATGCTGGCCCTTGCGCTTGTATCGTCGCGCAGCAACTGCGTAGCGATATCGTCTTTTCC
GCTTGGATGACTCTCTTCCTGGAGGCTTTTCACGTATGGCGCGTGCCGGACGAGTTACTGCCGGACGAGTTGCGC
CTCGAGGCTGGCTTCGTTATCCACGTCGCCATCCTTAGGGATGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail