Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2927
Gene name
Locationscaffold_233:19179..20555
Strand+
Gene length (bp)1376
Transcript length (bp)1188
Coding sequence length (bp)1185
Protein length (aa) 395

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10332 DUF2418 Protein of unknown function (DUF2418) 4.0E-34 163 267

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P87236|MU154_SCHPO Meiotically up-regulated gene 154 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug154 PE=1 SV=1 1 285 9.0E-21

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 83 105 22
2 180 199 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2927
MPRLVRRKPLRERVVALLNPMDLLLWLSEEVETREWDSQVVGTQLGLGLNSTLLLARANSAPVTPAANDDLFGEG
AGSSWLSLIVWPLVWALVVFSLTNAVYAFCRTRKYRLFQASVDTQPATPSVRRVKVHSSPASSSPLRFLADMVTP
QSAESRAHPDKDKDVWELSVWDPLPMSIRLLCFFSPGHALVYLLFLPLAPLDPRPSMTVFNSLVMQLVLTVQMLL
LCERFSQQGKDNTIIQKEVMREYDAKFVHPRLYPIVRDVGTQVSTDEPIEAPESVQLGTPATLLRRGFKTHGNPH
IDMPESTPASCYMRPHMFTPPPASRRVEAPAPSSGLRGSVLLTAQKEHQLERKPAHAEKLERNGSLGAAPPGAAE
QPDEAVQLSKGTHLDWADGD
Coding >Ophio5|2927
ATGCCCCGGCTGGTGCGTCGCAAGCCCCTTCGGGAACGCGTCGTCGCGTTGCTCAATCCCATGGATCTCCTACTC
TGGCTGTCTGAGGAGGTAGAGACGAGAGAATGGGACTCGCAAGTGGTGGGAACGCAGCTCGGCCTGGGCCTCAAT
TCTACCCTATTGCTGGCCCGCGCCAACTCGGCCCCGGTCACGCCCGCGGCCAACGACGACTTGTTTGGTGAAGGC
GCTGGCTCCAGCTGGCTTTCCCTCATCGTCTGGCCTCTTGTATGGGCTCTCGTCGTCTTCTCCCTGACCAACGCC
GTCTACGCCTTCTGCCGGACGAGAAAGTACCGCCTCTTCCAGGCCAGTGTCGATACGCAGCCTGCCACGCCCTCG
GTGCGTCGCGTCAAGGTTCATTCATCGCCTGCCTCATCCTCGCCGCTTCGTTTCCTGGCCGATATGGTGACGCCC
CAATCGGCCGAGTCGCGAGCCCATCCGGACAAGGACAAGGATGTGTGGGAGCTCTCCGTCTGGGACCCGCTGCCC
ATGTCGATCCGTCTCCTGTGCTTCTTCAGTCCTGGACACGCCCTCGTCTACTTGCTCTTTCTTCCGCTCGCTCCC
CTCGACCCTCGACCCAGCATGACGGTTTTTAACAGCTTGGTGATGCAGCTCGTACTGACGGTCCAAATGCTGCTA
CTGTGCGAGCGCTTCTCTCAGCAGGGCAAGGATAATACTATCATTCAGAAGGAAGTCATGCGCGAATACGACGCA
AAGTTCGTCCACCCCCGGCTGTATCCGATTGTCCGCGACGTGGGAACCCAAGTGTCTACGGACGAGCCGATCGAG
GCTCCTGAATCCGTGCAACTCGGTACACCTGCGACGCTCCTCAGGCGCGGTTTCAAGACACACGGCAACCCGCAT
ATCGACATGCCAGAGTCTACGCCTGCCAGCTGCTACATGAGGCCGCATATGTTTACGCCCCCTCCTGCTAGCCGA
CGGGTCGAGGCCCCAGCGCCGTCCTCTGGTCTTCGCGGCTCGGTCCTCCTCACCGCTCAAAAGGAACATCAGCTT
GAGCGAAAACCAGCCCACGCCGAGAAACTCGAGAGAAATGGCAGCTTGGGAGCAGCGCCCCCGGGAGCCGCCGAG
CAGCCCGACGAAGCAGTCCAACTCTCGAAAGGCACTCACCTCGACTGGGCAGACGGCGAC
Transcript >Ophio5|2927
ATGCCCCGGCTGGTGCGTCGCAAGCCCCTTCGGGAACGCGTCGTCGCGTTGCTCAATCCCATGGATCTCCTACTC
TGGCTGTCTGAGGAGGTAGAGACGAGAGAATGGGACTCGCAAGTGGTGGGAACGCAGCTCGGCCTGGGCCTCAAT
TCTACCCTATTGCTGGCCCGCGCCAACTCGGCCCCGGTCACGCCCGCGGCCAACGACGACTTGTTTGGTGAAGGC
GCTGGCTCCAGCTGGCTTTCCCTCATCGTCTGGCCTCTTGTATGGGCTCTCGTCGTCTTCTCCCTGACCAACGCC
GTCTACGCCTTCTGCCGGACGAGAAAGTACCGCCTCTTCCAGGCCAGTGTCGATACGCAGCCTGCCACGCCCTCG
GTGCGTCGCGTCAAGGTTCATTCATCGCCTGCCTCATCCTCGCCGCTTCGTTTCCTGGCCGATATGGTGACGCCC
CAATCGGCCGAGTCGCGAGCCCATCCGGACAAGGACAAGGATGTGTGGGAGCTCTCCGTCTGGGACCCGCTGCCC
ATGTCGATCCGTCTCCTGTGCTTCTTCAGTCCTGGACACGCCCTCGTCTACTTGCTCTTTCTTCCGCTCGCTCCC
CTCGACCCTCGACCCAGCATGACGGTTTTTAACAGCTTGGTGATGCAGCTCGTACTGACGGTCCAAATGCTGCTA
CTGTGCGAGCGCTTCTCTCAGCAGGGCAAGGATAATACTATCATTCAGAAGGAAGTCATGCGCGAATACGACGCA
AAGTTCGTCCACCCCCGGCTGTATCCGATTGTCCGCGACGTGGGAACCCAAGTGTCTACGGACGAGCCGATCGAG
GCTCCTGAATCCGTGCAACTCGGTACACCTGCGACGCTCCTCAGGCGCGGTTTCAAGACACACGGCAACCCGCAT
ATCGACATGCCAGAGTCTACGCCTGCCAGCTGCTACATGAGGCCGCATATGTTTACGCCCCCTCCTGCTAGCCGA
CGGGTCGAGGCCCCAGCGCCGTCCTCTGGTCTTCGCGGCTCGGTCCTCCTCACCGCTCAAAAGGAACATCAGCTT
GAGCGAAAACCAGCCCACGCCGAGAAACTCGAGAGAAATGGCAGCTTGGGAGCAGCGCCCCCGGGAGCCGCCGAG
CAGCCCGACGAAGCAGTCCAACTCTCGAAAGGCACTCACCTCGACTGGGCAGACGGCGACTAA
Gene >Ophio5|2927
ATGCCCCGGCTGGTGCGTCGCAAGCCCCTTCGGGAACGCGTCGTCGCGTTGCTCAATCCCATGGATCTCCTACTC
TGGCTGTCTGAGGAGGTAGAGACGAGAGAATGGGACTCGCAAGTGGTGGGAACGCAGCTCGGCCTGGGCCTCAAT
TCTACCCTATTGCTGGCCCGCGCCAACTCGGCCCCGGTCACGCCCGCGGCCAACGACGACTTGTTTGGTGAAGGC
GCTGGCTCCAGCTGGCTTTCCCTCATCGTGAGCTATTTCATCTCGACCGCGTTTATCTCTGCTGCTGACCCGCCG
TCCGATCTGTAGGTCTGGCCTCTTGTATGGGCTCTCGTCGTCTTCTCCCTGACCAACGCCGTCTACGCCTTCTGC
CGGACGAGAAAGTACCGCCTCTTCCAGGCCAGTGTCGATACGCAGCCTGCCACGCCCTCGGTGCGTCGCGTCAAG
GTTCATTCATCGCCTGCCTCATCCTCGCCGCTTCGTTTCCTGGCCGATATGGTGACGCCCCAATCGGCCGAGTCG
CGAGCCCATCCGGACAAGGACAAGGATGTGTGGGAGCTCTCCGTCTGGGACCCGCTGCCCATGTCGATCCGTCTC
CTGTGCTTCTTCAGTCCTGGACACGCCCTCGTCTACTTGCTCTTTCTTCCGCTCGCTCCCCTCGACCCTCGACCC
AGCATGACGGTTTTTAACAGCTTGGTGATGCAGCTCGTACTGACGGTCCAAATGCTGCTACTGTGCGAGCGCTTC
TCTCAGCAGGGCAAGGATAATACTATCATTCAGAAGGAAGTCATGCGCGAATACGACGCAAAGTTCGTCCACCCC
CGGCTGTATCCGATTGTCCGCGACGTGGGAACCCAAGTGTCTACGGACGAGCCGATCGAGGCTCCTGAATCCGTG
CAACTCGGTACACCTGCGACGCTCCTCAGGCGCGGTTTCAAGACACACGGCAACCCGCATATCGACATGCCAGAG
TCTACGCCTGCCAGCTGCTACATGAGGCCGCATATGTTTACGCCCCCTCCTGCTAGCCGACGGGTCGAGGCCCCA
GCGCCGTCCTCTGGTCTTCGCGGCTCGGTCCTCCGTAATACTAGCTTGCCGGTATCCCCCTCTCCGGCGGTGGCT
GCCGCGACGGCGCAAACCGGGACCGGCCCTCTTCCGGGAGGCGGCCACAACTTTGGGGGAATGTTTGGCGTGTAC
ACACATAACAAGTCACCGCTCAAAAGGAACATCAGCTTGAGCGAAAACCAGCCCACGCCGAGAAACTCGAGAGAA
ATGGCAGCTTGGGAGCAGCGCCCCCGGGAGCCGCCGAGCAGCCCGACGAAGCAGTCCAACTCTCGAAAGGCACTC
ACCTCGACTGGGCAGACGGCGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail