Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2926
Gene name
Locationscaffold_233:18232..18773
Strand-
Gene length (bp)541
Transcript length (bp)372
Coding sequence length (bp)369
Protein length (aa) 123

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01990 ATP-synt_F ATP synthase (F/14-kDa) subunit 1.6E-33 14 117

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y756|VATF_NEUCR V-type proton ATPase subunit F OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vma-7 PE=3 SV=1 3 123 2.0E-73
sp|A6RRW0|VATF_BOTFB V-type proton ATPase subunit F OS=Botryotinia fuckeliana (strain B05.10) GN=vma7 PE=3 SV=1 1 123 2.0E-69
sp|A1DH48|VATF_NEOFI V-type proton ATPase subunit F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=vma7 PE=3 SV=1 2 123 2.0E-64
sp|A7TMI5|VATF_VANPO V-type proton ATPase subunit F OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=VMA7 PE=3 SV=1 10 123 7.0E-46
sp|P39111|VATF_YEAST V-type proton ATPase subunit F OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA7 PE=1 SV=1 10 123 4.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y756|VATF_NEUCR V-type proton ATPase subunit F OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vma-7 PE=3 SV=1 3 123 2.0E-73
sp|A6RRW0|VATF_BOTFB V-type proton ATPase subunit F OS=Botryotinia fuckeliana (strain B05.10) GN=vma7 PE=3 SV=1 1 123 2.0E-69
sp|A1DH48|VATF_NEOFI V-type proton ATPase subunit F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=vma7 PE=3 SV=1 2 123 2.0E-64
sp|A7TMI5|VATF_VANPO V-type proton ATPase subunit F OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=VMA7 PE=3 SV=1 10 123 7.0E-46
sp|P39111|VATF_YEAST V-type proton ATPase subunit F OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA7 PE=1 SV=1 10 123 4.0E-44
sp|O43046|VATF_SCHPO V-type proton ATPase subunit F OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma7 PE=3 SV=1 1 123 2.0E-43
sp|Q55AH5|VATF_DICDI V-type proton ATPase subunit F OS=Dictyostelium discoideum GN=vatF PE=3 SV=1 1 122 5.0E-38
sp|Q23680|VATF_CAEEL Probable V-type proton ATPase subunit F OS=Caenorhabditis elegans GN=vha-9 PE=3 SV=1 1 121 1.0E-34
sp|P31478|VATF_MANSE V-type proton ATPase subunit F OS=Manduca sexta GN=VHA14 PE=2 SV=1 1 122 2.0E-34
sp|Q9I8H3|VATF_XENLA V-type proton ATPase subunit F (Fragment) OS=Xenopus laevis GN=atp6s14 PE=2 SV=1 15 121 1.0E-33
sp|Q17029|VATF_ANOGA V-type proton ATPase subunit F OS=Anopheles gambiae GN=Vha14 PE=2 SV=2 11 122 8.0E-33
sp|Q9ZQX4|VATF_ARATH V-type proton ATPase subunit F OS=Arabidopsis thaliana GN=VHA-F PE=2 SV=1 1 122 9.0E-33
sp|O44091|VATF1_DROPS V-type proton ATPase subunit F 1 OS=Drosophila pseudoobscura pseudoobscura GN=Vha14 PE=2 SV=2 1 122 1.0E-32
sp|Q16864|VATF_HUMAN V-type proton ATPase subunit F OS=Homo sapiens GN=ATP6V1F PE=1 SV=2 11 121 1.0E-32
sp|Q24583|VATF1_DROME V-type proton ATPase subunit F 1 OS=Drosophila melanogaster GN=Vha14-1 PE=1 SV=1 1 122 1.0E-32
sp|Q1HQK8|VATF_AEDAE V-type proton ATPase subunit F OS=Aedes aegypti GN=AAEL002464 PE=2 SV=1 11 122 2.0E-32
sp|Q28029|VATF_BOVIN V-type proton ATPase subunit F OS=Bos taurus GN=ATP6V1F PE=3 SV=2 11 121 2.0E-32
sp|P50408|VATF_RAT V-type proton ATPase subunit F OS=Rattus norvegicus GN=Atp6v1f PE=1 SV=1 11 121 5.0E-32
sp|Q9D1K2|VATF_MOUSE V-type proton ATPase subunit F OS=Mus musculus GN=Atp6v1f PE=1 SV=2 11 121 5.0E-32
sp|Q9VNL3|VATF2_DROME Probable V-type proton ATPase subunit F 2 OS=Drosophila melanogaster GN=Vha14-2 PE=3 SV=2 50 121 5.0E-16
sp|O27037|VATF_METTH V-type ATP synthase subunit F OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=atpF PE=3 SV=1 13 122 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046961 proton-transporting ATPase activity, rotational mechanism Yes
GO:0034220 ion transmembrane transport Yes
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0022804 active transmembrane transporter activity No
GO:0140657 ATP-dependent activity No
GO:0051234 establishment of localization No
GO:0022853 active ion transmembrane transporter activity No
GO:0019829 ATPase-coupled cation transmembrane transporter activity No
GO:0006810 transport No
GO:0051179 localization No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0022857 transmembrane transporter activity No
GO:0055085 transmembrane transport No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0009678 pyrophosphate hydrolysis-driven proton transmembrane transporter activity No
GO:0009987 cellular process No
GO:0044769 ATPase activity, coupled to transmembrane movement of ions, rotational mechanism No
GO:0042625 ATPase-coupled ion transmembrane transporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0006811 ion transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015078 proton transmembrane transporter activity No
GO:0015399 primary active transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2926
MASQADFKDREFLAVIGDEDSVTGLLLAGIGHVTAGADAEKNFLVVDSKTDTAAIEAAFDRFTQGRKDIGIVLIN
QHIADRIRHRVDTYTAAFPTVLEIPSKDHPYDPEKDSVLRRVRRLFGE
Coding >Ophio5|2926
ATGGCGTCACAAGCAGACTTCAAGGATCGGGAGTTTCTGGCCGTCATCGGCGACGAGGACTCGGTAACGGGCCTC
CTCCTCGCTGGTATCGGCCACGTCACCGCCGGTGCGGACGCGGAGAAAAACTTCCTCGTTGTCGATAGCAAGACG
GACACGGCGGCCATCGAGGCGGCCTTTGATCGCTTCACGCAAGGGAGAAAAGACATTGGCATCGTCCTCATCAAT
CAGCATATTGCCGACAGAATACGCCACCGCGTCGACACATATACCGCTGCTTTTCCCACCGTTCTGGAGATCCCT
AGCAAAGACCACCCATACGACCCCGAGAAGGACAGTGTTCTGCGGCGCGTGCGCCGCCTGTTCGGCGAA
Transcript >Ophio5|2926
ATGGCGTCACAAGCAGACTTCAAGGATCGGGAGTTTCTGGCCGTCATCGGCGACGAGGACTCGGTAACGGGCCTC
CTCCTCGCTGGTATCGGCCACGTCACCGCCGGTGCGGACGCGGAGAAAAACTTCCTCGTTGTCGATAGCAAGACG
GACACGGCGGCCATCGAGGCGGCCTTTGATCGCTTCACGCAAGGGAGAAAAGACATTGGCATCGTCCTCATCAAT
CAGCATATTGCCGACAGAATACGCCACCGCGTCGACACATATACCGCTGCTTTTCCCACCGTTCTGGAGATCCCT
AGCAAAGACCACCCATACGACCCCGAGAAGGACAGTGTTCTGCGGCGCGTGCGCCGCCTGTTCGGCGAATAA
Gene >Ophio5|2926
ATGGCGTCACAAGCAGACTTCAAGGATCGGGAGTTTCTGGCCGTCATCGGCGACGAGGTGTGTCGGCACCGGCTC
AAAAGGTGTTGCAGCGACGAAAGACTGACCGACTCCGGCACAGGACTCGGTAACGGGCCTCCTCCTCGCTGGTAT
CGGCGTATGTCGTGCGCCGGCCCTGGACCCCGAGGACTGTGCCGCTGACGACGAAAGCGCAGCACGTCACCGCCG
GTGCGGACGCGGAGAAAAACTTCCTCGTTGTCGATAGCAAGACGGACACGGCGGCCATCGAGGCGGCCTTTGATC
GCTTCACGCAAGGGAGAAAAGACATTGGCATCGTCCTCATCAATCAGCATGTTCGTCGCCTGGCTTCGTTGTAAT
GTTCGAAGTTCTGATAATCCCCCAGATTGCCGACAGAATACGCCACCGCGTCGACACATATACCGCTGCTTTTCC
CACCGTTCTGGAGATCCCTAGCAAAGACCACCCATACGACCCCGAGAAGGACAGTGTTCTGCGGCGCGTGCGCCG
CCTGTTCGGCGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail