Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2925
Gene name
Locationscaffold_233:17249..17857
Strand+
Gene length (bp)608
Transcript length (bp)501
Coding sequence length (bp)498
Protein length (aa) 166

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02221 E1_DerP2_DerF2 ML domain 6.5E-27 41 156

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RZ85|NPC2_NEUCR Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=npc-2 PE=3 SV=1 1 161 2.0E-49
sp|Q52FS9|NPC2_MAGO7 Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NPC2 PE=3 SV=2 1 161 2.0E-48
sp|O94183|NPC2_ASPOR Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pltp PE=1 SV=1 1 158 1.0E-42
sp|Q4X136|NPC2_ASPFU Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=npc2 PE=3 SV=2 3 152 7.0E-39
sp|Q5B0Q1|NPC2_EMENI Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=npc2 PE=3 SV=1 19 152 1.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RZ85|NPC2_NEUCR Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=npc-2 PE=3 SV=1 1 161 2.0E-49
sp|Q52FS9|NPC2_MAGO7 Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NPC2 PE=3 SV=2 1 161 2.0E-48
sp|O94183|NPC2_ASPOR Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pltp PE=1 SV=1 1 158 1.0E-42
sp|Q4X136|NPC2_ASPFU Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=npc2 PE=3 SV=2 3 152 7.0E-39
sp|Q5B0Q1|NPC2_EMENI Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=npc2 PE=3 SV=1 19 152 1.0E-38
sp|Q6CHU5|NPC2_YARLI Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NPC2 PE=3 SV=1 6 156 1.0E-37
sp|Q5A8A2|NPC2_CANAL Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NPC2 PE=3 SV=1 3 156 8.0E-37
sp|Q6BV42|NPC2_DEBHA Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NPC2 PE=3 SV=1 22 156 2.0E-35
sp|Q756Q3|NPC2_ASHGO Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NPC2 PE=3 SV=1 1 156 5.0E-33
sp|D4AYQ6|NPC2_ARTBC Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01325 PE=1 SV=1 23 157 6.0E-33
sp|Q6CNE0|NPC2_KLULA Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NPC2 PE=3 SV=1 23 156 1.0E-30
sp|Q12408|NPC2_YEAST Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NPC2 PE=1 SV=1 28 156 1.0E-29
sp|Q9C0X9|NPC2_SCHPO Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=npc2 PE=3 SV=1 19 166 2.0E-27
sp|Q6FNB1|NPC2_CANGA Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NPC2 PE=3 SV=1 21 156 4.0E-24
sp|P0CP28|NPC2_CRYNJ Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NPC2 PE=3 SV=1 10 156 2.0E-23
sp|P0CP29|NPC2_CRYNB Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NPC2 PE=3 SV=1 10 156 2.0E-23
sp|Q4P580|NPC2_USTMA Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NPC2 PE=3 SV=1 42 156 5.0E-23
sp|Q54SZ8|NPC22_DICDI Putative phosphatidylglycerol/phosphatidylinositol transfer protein 2 OS=Dictyostelium discoideum GN=DDB_G0282109 PE=3 SV=1 40 156 1.0E-11
sp|Q54KP7|NPC23_DICDI Putative phosphatidylglycerol/phosphatidylinositol transfer protein 3 OS=Dictyostelium discoideum GN=DDB_G0287185 PE=3 SV=1 40 155 4.0E-11
sp|Q54SZ9|Y2107_DICDI Putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282107 OS=Dictyostelium discoideum GN=DDB_G0282107 PE=3 SV=1 42 156 8.0E-11
sp|Q54YD2|Y8295_DICDI Putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0278295 OS=Dictyostelium discoideum GN=DDB_G0278295 PE=2 SV=1 42 156 3.0E-10
sp|Q55BL4|NPC21_DICDI Putative phosphatidylglycerol/phosphatidylinositol transfer protein 1 OS=Dictyostelium discoideum GN=DDB_G0270454 PE=3 SV=1 40 155 5.0E-10
sp|Q54SW1|Y2179_DICDI Putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 OS=Dictyostelium discoideum GN=DDB_G0282179 PE=3 SV=2 34 151 4.0E-09
sp|Q54MV4|Y8563_DICDI Putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0285639 OS=Dictyostelium discoideum GN=DDB_G0285639 PE=3 SV=1 40 157 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2925
MRFFTAVALLSASLASAAVVAEDHKVPGGSPLLFCDGYIPRDFVDIKSVKLTPTNPEAGKNLTIEARGTVHKDIR
KGAYVRLEVKWGLITLLRTVQDLCEQTSNIDLECPIKAGDMTLKKTVQLPKAIPDGTYNVLADVYSEDDQHITCL
TASVSFHGNSLFNLEL
Coding >Ophio5|2925
ATGAGGTTCTTCACAGCTGTCGCGCTTCTTTCCGCCAGCCTGGCGTCGGCGGCCGTTGTCGCCGAGGATCACAAG
GTCCCGGGAGGCTCTCCCCTGCTGTTCTGCGACGGCTACATTCCCAGAGATTTTGTCGACATCAAGAGCGTCAAA
CTCACTCCCACCAATCCTGAAGCTGGCAAGAATCTGACAATCGAGGCCCGTGGAACAGTCCATAAGGACATCCGC
AAGGGCGCCTACGTTCGCCTCGAAGTCAAATGGGGCCTCATCACCCTTCTCAGAACGGTGCAGGATCTCTGCGAG
CAGACAAGCAACATCGACCTCGAGTGCCCCATCAAGGCTGGCGATATGACGCTCAAGAAGACGGTTCAATTACCG
AAGGCGATTCCTGATGGTACCTACAATGTCCTGGCCGATGTGTACTCGGAAGATGACCAGCACATCACATGCCTG
ACGGCTAGCGTCTCTTTTCATGGAAACAGTCTGTTCAACCTCGAGCTT
Transcript >Ophio5|2925
ATGAGGTTCTTCACAGCTGTCGCGCTTCTTTCCGCCAGCCTGGCGTCGGCGGCCGTTGTCGCCGAGGATCACAAG
GTCCCGGGAGGCTCTCCCCTGCTGTTCTGCGACGGCTACATTCCCAGAGATTTTGTCGACATCAAGAGCGTCAAA
CTCACTCCCACCAATCCTGAAGCTGGCAAGAATCTGACAATCGAGGCCCGTGGAACAGTCCATAAGGACATCCGC
AAGGGCGCCTACGTTCGCCTCGAAGTCAAATGGGGCCTCATCACCCTTCTCAGAACGGTGCAGGATCTCTGCGAG
CAGACAAGCAACATCGACCTCGAGTGCCCCATCAAGGCTGGCGATATGACGCTCAAGAAGACGGTTCAATTACCG
AAGGCGATTCCTGATGGTACCTACAATGTCCTGGCCGATGTGTACTCGGAAGATGACCAGCACATCACATGCCTG
ACGGCTAGCGTCTCTTTTCATGGAAACAGTCTGTTCAACCTCGAGCTTTAG
Gene >Ophio5|2925
ATGAGGTTCTTCACAGCTGTCGCGCTTCTTTCCGCCAGCCTGGCGTCGGCGGCCGTTGTCGCCGAGGATCACAAG
GTCCCGGGAGGCTCTCCCCTGCTGTTCTGCGACGGCTACATTCCCAGAGATTTTGTCGACATCAAGAGCGTCAAA
CTCACTCCCACCAATCCTGAAGCGTATGGCCGCCGTGTCTGTCACGTTTGGTAATACGCACGCTGACTTTCGGCC
AGTGGCAAGAATCTGACAATCGAGGCCCGTGGAACAGTCCATAAGGACATCCGCAAGGGCGCCTACGTTCGCCTC
GAAGTCAAATGGGGCCTCATCACCCTTCTCAGAACGGTGCAGGATCTCTGCGAGCAGACAAGCAACATCGACCTC
GAGTGCCCCATCAAGGCTGGCGATATGACGCTCAAGAAGACGGTTCAATTACCGAAGGCGATTCCTGATGTACGT
GACCTGCACCCGTCGCCTCAGGACGACAAAACTGACCTTGCTTGCAGGGTACCTACAATGTCCTGGCCGATGTGT
ACTCGGAAGATGACCAGCACATCACATGCCTGACGGCTAGCGTCTCTTTTCATGGAAACAGTCTGTTCAACCTCG
AGCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail