Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2922
Gene name
Locationscaffold_233:8895..10372
Strand+
Gene length (bp)1477
Transcript length (bp)1395
Coding sequence length (bp)1392
Protein length (aa) 464

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00953 Glycos_transf_4 Glycosyl transferase family 4 2.2E-30 144 317

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P07286|GPT_YEAST UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG7 PE=3 SV=1 16 461 9.0E-138
sp|P42881|GPT_SCHPO UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpt2 PE=3 SV=1 16 457 7.0E-127
sp|Q5EA65|GPT_BOVIN UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Bos taurus GN=DPAGT1 PE=2 SV=1 34 454 2.0E-101
sp|Q9H3H5|GPT_HUMAN UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Homo sapiens GN=DPAGT1 PE=1 SV=2 34 423 2.0E-100
sp|P42867|GPT_MOUSE UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Mus musculus GN=Dpagt1 PE=1 SV=2 42 423 2.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P07286|GPT_YEAST UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG7 PE=3 SV=1 16 461 9.0E-138
sp|P42881|GPT_SCHPO UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpt2 PE=3 SV=1 16 457 7.0E-127
sp|Q5EA65|GPT_BOVIN UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Bos taurus GN=DPAGT1 PE=2 SV=1 34 454 2.0E-101
sp|Q9H3H5|GPT_HUMAN UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Homo sapiens GN=DPAGT1 PE=1 SV=2 34 423 2.0E-100
sp|P42867|GPT_MOUSE UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Mus musculus GN=Dpagt1 PE=1 SV=2 42 423 2.0E-98
sp|P24140|GPT_CRIGR UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Cricetulus griseus GN=DPAGT1 PE=2 SV=1 34 423 2.0E-95
sp|P23338|GPT_CRILO UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Cricetulus longicaudatus GN=DPAGT1 PE=2 SV=1 34 423 6.0E-94
sp|P0CD61|GPT_DICDI UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Dictyostelium discoideum GN=alg7 PE=3 SV=1 35 447 8.0E-74
sp|P42864|GPT_LEIAM UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Leishmania amazonensis GN=NAGT PE=3 SV=1 137 455 9.0E-45
sp|P96000|GPT_SULSO Putative UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=gnpTA PE=3 SV=1 146 378 3.0E-12
sp|P39465|GPT_SULAC Putative UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=gnpTA PE=3 SV=1 43 342 5.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0008963 phospho-N-acetylmuramoyl-pentapeptide-transferase activity Yes
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0110165 cellular anatomical entity No
GO:0016780 phosphotransferase activity, for other substituted phosphate groups No
GO:0031224 intrinsic component of membrane No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 35 57 22
2 78 100 22
3 139 158 19
4 170 192 22
5 202 224 22
6 231 250 19
7 270 292 22
8 305 327 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2922
MEPSLSRTETLSLISLSIGSLATIVNTVRSDGEPLMASAALSVASFALCYAMIRWLGPAFMRAGLRGRDMGKASG
GDLPECMGAVAAAVYLLAVIVFIPFPFYKDIVAATSGGGNRDVVLEAPHVHQGRFLHRFPHNKLASYLGAIISLQ
TVSLLGIGDDLFDIRWRHKWWIPGLASVPLLVVYLVDFGVTSVVIPLQLQPYLGELFDLGSLYYVYMACVAMFCP
QSINMLAGINGIEVSQCLAVAALLAFNDGLYLLSPYPNPATDSHLFSLYLLLPWIGVSAALLCHNWYPAKVFVGD
TYCYFSGMVFAVVGILGHFSKTLGLLLVPQIFNFLYSCPQIFGIIPCPRHRLPKFNARTGRLEPSVVTWSPDRQP
HPLVTRALHLLAALRLVRLAHDPQGRLTESSNFTLINLWLIWRGPLREPRLASELTALQLAVGLFGLFVRHRLAL
LVFKEDNWGTAVRP
Coding >Ophio5|2922
ATGGAACCATCCCTCTCCCGGACCGAAACCTTGTCCCTCATCTCCCTCTCCATCGGCTCCCTCGCCACCATCGTC
AACACGGTACGATCCGATGGCGAGCCGCTGATGGCCTCTGCCGCGCTTTCCGTCGCCTCCTTCGCTCTTTGCTAC
GCCATGATTCGTTGGCTGGGCCCGGCCTTTATGCGTGCCGGCTTGCGAGGTCGGGATATGGGCAAGGCGAGCGGG
GGGGACTTGCCCGAGTGTATGGGAGCCGTTGCCGCCGCTGTCTACCTGCTTGCTGTTATCGTCTTTATCCCCTTT
CCTTTTTATAAGGATATCGTGGCCGCGACGAGTGGTGGGGGGAATAGGGATGTGGTGCTTGAGGCGCCTCATGTT
CATCAGGGGAGGTTTTTGCATCGCTTTCCCCATAACAAGCTTGCCTCCTACCTCGGCGCCATCATATCCCTCCAG
ACAGTCTCCCTCCTCGGCATAGGCGATGATCTCTTCGATATCCGCTGGCGCCACAAGTGGTGGATCCCCGGCCTC
GCGTCGGTGCCGCTGCTCGTCGTTTACCTCGTCGACTTTGGCGTAACCTCGGTCGTGATCCCTCTCCAGCTACAG
CCCTACCTCGGCGAGCTTTTCGACCTCGGCTCCCTCTACTACGTCTACATGGCCTGTGTCGCCATGTTCTGCCCG
CAGAGCATCAACATGTTGGCCGGCATCAACGGCATAGAGGTTTCGCAGTGCCTCGCTGTCGCCGCCCTCCTCGCC
TTCAATGACGGCCTCTATCTTCTAAGCCCCTATCCGAACCCGGCTACCGACTCGCACCTCTTTTCGCTCTACCTT
TTACTCCCTTGGATAGGCGTATCGGCCGCCCTCCTCTGCCATAATTGGTATCCCGCAAAGGTCTTCGTCGGCGAT
ACCTACTGCTACTTCTCCGGCATGGTCTTCGCCGTCGTCGGCATCCTCGGCCACTTCTCCAAGACGCTCGGCCTA
CTGCTCGTCCCCCAAATCTTCAACTTTCTCTACTCCTGCCCCCAAATCTTCGGAATCATTCCCTGCCCCCGTCAT
CGGCTCCCCAAATTCAACGCCCGTACCGGCAGACTCGAGCCGTCCGTCGTCACTTGGTCCCCCGATCGCCAACCT
CATCCACTCGTCACCCGCGCCCTGCACCTACTCGCCGCTCTGCGCCTCGTCCGTCTCGCCCATGATCCGCAGGGC
CGCCTCACCGAGTCGTCCAACTTCACCCTCATTAACCTCTGGCTCATCTGGCGCGGGCCTCTTCGCGAGCCTCGC
CTCGCCTCGGAGCTGACCGCTCTGCAGCTCGCTGTCGGCCTCTTCGGCCTCTTCGTCCGCCACCGGCTGGCTCTG
CTTGTCTTTAAGGAAGACAACTGGGGCACAGCCGTTCGGCCG
Transcript >Ophio5|2922
ATGGAACCATCCCTCTCCCGGACCGAAACCTTGTCCCTCATCTCCCTCTCCATCGGCTCCCTCGCCACCATCGTC
AACACGGTACGATCCGATGGCGAGCCGCTGATGGCCTCTGCCGCGCTTTCCGTCGCCTCCTTCGCTCTTTGCTAC
GCCATGATTCGTTGGCTGGGCCCGGCCTTTATGCGTGCCGGCTTGCGAGGTCGGGATATGGGCAAGGCGAGCGGG
GGGGACTTGCCCGAGTGTATGGGAGCCGTTGCCGCCGCTGTCTACCTGCTTGCTGTTATCGTCTTTATCCCCTTT
CCTTTTTATAAGGATATCGTGGCCGCGACGAGTGGTGGGGGGAATAGGGATGTGGTGCTTGAGGCGCCTCATGTT
CATCAGGGGAGGTTTTTGCATCGCTTTCCCCATAACAAGCTTGCCTCCTACCTCGGCGCCATCATATCCCTCCAG
ACAGTCTCCCTCCTCGGCATAGGCGATGATCTCTTCGATATCCGCTGGCGCCACAAGTGGTGGATCCCCGGCCTC
GCGTCGGTGCCGCTGCTCGTCGTTTACCTCGTCGACTTTGGCGTAACCTCGGTCGTGATCCCTCTCCAGCTACAG
CCCTACCTCGGCGAGCTTTTCGACCTCGGCTCCCTCTACTACGTCTACATGGCCTGTGTCGCCATGTTCTGCCCG
CAGAGCATCAACATGTTGGCCGGCATCAACGGCATAGAGGTTTCGCAGTGCCTCGCTGTCGCCGCCCTCCTCGCC
TTCAATGACGGCCTCTATCTTCTAAGCCCCTATCCGAACCCGGCTACCGACTCGCACCTCTTTTCGCTCTACCTT
TTACTCCCTTGGATAGGCGTATCGGCCGCCCTCCTCTGCCATAATTGGTATCCCGCAAAGGTCTTCGTCGGCGAT
ACCTACTGCTACTTCTCCGGCATGGTCTTCGCCGTCGTCGGCATCCTCGGCCACTTCTCCAAGACGCTCGGCCTA
CTGCTCGTCCCCCAAATCTTCAACTTTCTCTACTCCTGCCCCCAAATCTTCGGAATCATTCCCTGCCCCCGTCAT
CGGCTCCCCAAATTCAACGCCCGTACCGGCAGACTCGAGCCGTCCGTCGTCACTTGGTCCCCCGATCGCCAACCT
CATCCACTCGTCACCCGCGCCCTGCACCTACTCGCCGCTCTGCGCCTCGTCCGTCTCGCCCATGATCCGCAGGGC
CGCCTCACCGAGTCGTCCAACTTCACCCTCATTAACCTCTGGCTCATCTGGCGCGGGCCTCTTCGCGAGCCTCGC
CTCGCCTCGGAGCTGACCGCTCTGCAGCTCGCTGTCGGCCTCTTCGGCCTCTTCGTCCGCCACCGGCTGGCTCTG
CTTGTCTTTAAGGAAGACAACTGGGGCACAGCCGTTCGGCCGTGA
Gene >Ophio5|2922
ATGGAACCATCCCTCTCCCGGACCGAAACCTTGTCCCTCATCTCCCTCTCCATCGGCTCCCTCGCCACCATCGTC
AACACGGTACGATCCGATGGCGAGCCGCTGATGGCCTCTGCCGCGCTTTCCGTCGCCTCCTTCGCTCTTTGCTAC
GCCATGATTCGTTGGCTGGGCCCGGCCTTTATGCGTGCCGGCTTGCGAGGTCGGGATATGGGCAAGGCGAGCGGG
GGGGACTTGCCCGAGTGTATGGGAGCCGTTGCCGCCGCTGTCTACCTGCTTGCTGTTATCGTCTTTATCCCCTTT
CCTTTTTATAAGGATATCGTGGCCGCGACGAGTGGTGGGGGGAATAGGGATGTGGTGCTTGAGGCGCCTCATGTT
CATCAGGGGAGGTTTTTGCATCGCTTTCCCCATAACAAGGTGTGTCTTTCTTTTCTTGTTCTTCTCACCGGCCCT
TGCTTTACTCTCTCACACCTCCCCCGCTGATGTACCCGTCTCGAAGCTTGCCTCCTACCTCGGCGCCATCATATC
CCTCCAGACAGTCTCCCTCCTCGGCATAGGCGATGATCTCTTCGATATCCGCTGGCGCCACAAGTGGTGGATCCC
CGGCCTCGCGTCGGTGCCGCTGCTCGTCGTTTACCTCGTCGACTTTGGCGTAACCTCGGTCGTGATCCCTCTCCA
GCTACAGCCCTACCTCGGCGAGCTTTTCGACCTCGGCTCCCTCTACTACGTCTACATGGCCTGTGTCGCCATGTT
CTGCCCGCAGAGCATCAACATGTTGGCCGGCATCAACGGCATAGAGGTTTCGCAGTGCCTCGCTGTCGCCGCCCT
CCTCGCCTTCAATGACGGCCTCTATCTTCTAAGCCCCTATCCGAACCCGGCTACCGACTCGCACCTCTTTTCGCT
CTACCTTTTACTCCCTTGGATAGGCGTATCGGCCGCCCTCCTCTGCCATAATTGGTATCCCGCAAAGGTCTTCGT
CGGCGATACCTACTGCTACTTCTCCGGCATGGTCTTCGCCGTCGTCGGCATCCTCGGCCACTTCTCCAAGACGCT
CGGCCTACTGCTCGTCCCCCAAATCTTCAACTTTCTCTACTCCTGCCCCCAAATCTTCGGAATCATTCCCTGCCC
CCGTCATCGGCTCCCCAAATTCAACGCCCGTACCGGCAGACTCGAGCCGTCCGTCGTCACTTGGTCCCCCGATCG
CCAACCTCATCCACTCGTCACCCGCGCCCTGCACCTACTCGCCGCTCTGCGCCTCGTCCGTCTCGCCCATGATCC
GCAGGGCCGCCTCACCGAGTCGTCCAACTTCACCCTCATTAACCTCTGGCTCATCTGGCGCGGGCCTCTTCGCGA
GCCTCGCCTCGCCTCGGAGCTGACCGCTCTGCAGCTCGCTGTCGGCCTCTTCGGCCTCTTCGTCCGCCACCGGCT
GGCTCTGCTTGTCTTTAAGGAAGACAACTGGGGCACAGCCGTTCGGCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail