Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2916
Gene name
Locationscaffold_232:20259..22031
Strand+
Gene length (bp)1772
Transcript length (bp)1659
Coding sequence length (bp)1656
Protein length (aa) 552

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 6.3E-26 121 525

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38680|MTR_NEUCR N amino acid transport system protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mtr PE=3 SV=2 90 547 2.0E-59

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.5

Transmembrane Domains

Domain # Start End Length
1 129 151 22
2 156 178 22
3 198 220 22
4 235 257 22
5 264 286 22
6 317 339 22
7 351 373 22
8 397 419 22
9 431 453 22
10 463 485 22
11 505 527 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2916
MDRQPSAPEKPLGPNPPGQQQTTASRTFSGTSSTSPPPLTPPRRGRRRAMVGACVLGGAGVTIGPRITALPEWLK
DENAAAAAAAAAAGSSSDDDVDNDASNAIVNRQLASETGRSIQYRTCSWQKTAALLFSEYICLAIMSFPWSYSFL
GLVPGLILTVVIAAVVLYTSLVLWQLCLRHPEVRDVCDLGQMLFWQKPWAWWATAIMFVLNNTFIQGLHVLVGAE
YLNTMTESRIITGCRTVQFSLVVTIVCWLASLPRTFSMLSKLGTAAAFFTFVAVILATVFAAVQPQPAGYDPAKG
MPRWTALPVHSTTFVQGMAAFLNISYTFIGQITLPSFIAEMRDPREFPKSLWACTVAEIITFSIVGAVIYVYTGN
QYVKSPAFGSLEDLYKKVSFSFMIPTIIFLGCLYASVTARFVFFRVFRGSRHLNDHTVVGWACWGGILLCTWIMA
FLISQLIPFFSSLLSVMSSLFDSWFGFIFWGVAYFRMRNADLAAGFRRRPLADMFSIGLNVVIILTGLFFLTVGT
YASVQGIADAFRAGEVGGVFSCKSNGV
Coding >Ophio5|2916
ATGGACCGACAACCTTCCGCCCCAGAGAAGCCCTTGGGGCCAAACCCTCCCGGACAACAACAGACAACAGCATCC
CGCACCTTCAGCGGAACCTCATCAACCTCACCGCCCCCGCTCACGCCTCCACGCCGAGGCCGGCGTCGCGCCATG
GTAGGAGCCTGCGTCCTAGGCGGCGCAGGAGTCACCATCGGACCACGAATCACGGCATTACCAGAATGGCTCAAG
GACGAGAACGCAGCAGCGGCAGCAGCGGCAGCAGCAGCAGGCTCATCATCAGACGACGACGTCGATAACGACGCG
AGTAACGCAATCGTCAACAGACAACTCGCTTCCGAAACCGGTCGATCGATTCAATATCGTACCTGCAGCTGGCAG
AAGACGGCGGCCTTACTATTCAGCGAGTATATCTGTTTGGCCATTATGAGCTTTCCTTGGTCATATAGTTTCCTA
GGACTTGTGCCGGGTTTGATTCTTACCGTTGTCATCGCTGCTGTCGTTCTTTACACTAGCTTGGTCTTGTGGCAG
CTTTGCTTGAGGCATCCTGAAGTTCGGGACGTTTGTGATCTCGGTCAGATGTTGTTTTGGCAAAAACCTTGGGCT
TGGTGGGCCACAGCCATCATGTTCGTTCTGAACAACACTTTTATCCAGGGTTTACACGTCCTCGTCGGAGCAGAA
TATCTCAACACCATGACCGAGTCGCGTATCATTACTGGCTGTCGAACCGTTCAGTTTTCTCTCGTCGTCACCATC
GTCTGCTGGCTCGCTTCGTTACCGCGCACATTCAGCATGCTGTCTAAGCTGGGCACCGCCGCCGCCTTCTTCACC
TTTGTGGCTGTCATCCTAGCGACCGTCTTTGCTGCTGTCCAGCCTCAGCCTGCGGGGTACGATCCGGCAAAGGGT
ATGCCGCGATGGACTGCGTTGCCGGTCCATAGCACCACCTTTGTTCAGGGCATGGCTGCCTTTCTCAACATCAGC
TACACCTTTATCGGGCAGATTACCCTGCCCAGCTTCATCGCCGAGATGCGTGACCCACGCGAGTTCCCCAAGTCT
CTCTGGGCTTGCACCGTGGCGGAAATCATCACCTTTAGCATTGTCGGCGCCGTCATCTACGTCTATACCGGGAAC
CAATACGTCAAGTCTCCGGCTTTTGGCTCTCTCGAAGACCTCTACAAGAAGGTGTCCTTTTCCTTCATGATCCCT
ACCATCATCTTTCTCGGCTGCCTGTACGCTTCTGTCACGGCTCGCTTCGTCTTCTTTCGCGTCTTTCGCGGCTCG
CGACACCTTAACGACCACACCGTCGTCGGCTGGGCATGCTGGGGTGGCATCCTGCTGTGCACCTGGATCATGGCC
TTTTTGATTTCCCAGCTGATTCCCTTCTTCTCGTCCCTACTGTCTGTCATGTCATCCCTCTTCGACAGCTGGTTC
GGCTTCATCTTCTGGGGCGTCGCCTACTTCCGCATGCGTAACGCCGATCTCGCCGCCGGGTTCCGCCGTCGGCCC
TTGGCAGACATGTTTTCCATAGGTCTCAACGTCGTCATCATCCTCACTGGCCTCTTCTTCCTCACCGTCGGCACC
TACGCCAGCGTCCAGGGAATCGCTGACGCTTTCCGTGCCGGCGAGGTCGGTGGCGTCTTTTCCTGCAAGAGCAAC
GGCGTC
Transcript >Ophio5|2916
ATGGACCGACAACCTTCCGCCCCAGAGAAGCCCTTGGGGCCAAACCCTCCCGGACAACAACAGACAACAGCATCC
CGCACCTTCAGCGGAACCTCATCAACCTCACCGCCCCCGCTCACGCCTCCACGCCGAGGCCGGCGTCGCGCCATG
GTAGGAGCCTGCGTCCTAGGCGGCGCAGGAGTCACCATCGGACCACGAATCACGGCATTACCAGAATGGCTCAAG
GACGAGAACGCAGCAGCGGCAGCAGCGGCAGCAGCAGCAGGCTCATCATCAGACGACGACGTCGATAACGACGCG
AGTAACGCAATCGTCAACAGACAACTCGCTTCCGAAACCGGTCGATCGATTCAATATCGTACCTGCAGCTGGCAG
AAGACGGCGGCCTTACTATTCAGCGAGTATATCTGTTTGGCCATTATGAGCTTTCCTTGGTCATATAGTTTCCTA
GGACTTGTGCCGGGTTTGATTCTTACCGTTGTCATCGCTGCTGTCGTTCTTTACACTAGCTTGGTCTTGTGGCAG
CTTTGCTTGAGGCATCCTGAAGTTCGGGACGTTTGTGATCTCGGTCAGATGTTGTTTTGGCAAAAACCTTGGGCT
TGGTGGGCCACAGCCATCATGTTCGTTCTGAACAACACTTTTATCCAGGGTTTACACGTCCTCGTCGGAGCAGAA
TATCTCAACACCATGACCGAGTCGCGTATCATTACTGGCTGTCGAACCGTTCAGTTTTCTCTCGTCGTCACCATC
GTCTGCTGGCTCGCTTCGTTACCGCGCACATTCAGCATGCTGTCTAAGCTGGGCACCGCCGCCGCCTTCTTCACC
TTTGTGGCTGTCATCCTAGCGACCGTCTTTGCTGCTGTCCAGCCTCAGCCTGCGGGGTACGATCCGGCAAAGGGT
ATGCCGCGATGGACTGCGTTGCCGGTCCATAGCACCACCTTTGTTCAGGGCATGGCTGCCTTTCTCAACATCAGC
TACACCTTTATCGGGCAGATTACCCTGCCCAGCTTCATCGCCGAGATGCGTGACCCACGCGAGTTCCCCAAGTCT
CTCTGGGCTTGCACCGTGGCGGAAATCATCACCTTTAGCATTGTCGGCGCCGTCATCTACGTCTATACCGGGAAC
CAATACGTCAAGTCTCCGGCTTTTGGCTCTCTCGAAGACCTCTACAAGAAGGTGTCCTTTTCCTTCATGATCCCT
ACCATCATCTTTCTCGGCTGCCTGTACGCTTCTGTCACGGCTCGCTTCGTCTTCTTTCGCGTCTTTCGCGGCTCG
CGACACCTTAACGACCACACCGTCGTCGGCTGGGCATGCTGGGGTGGCATCCTGCTGTGCACCTGGATCATGGCC
TTTTTGATTTCCCAGCTGATTCCCTTCTTCTCGTCCCTACTGTCTGTCATGTCATCCCTCTTCGACAGCTGGTTC
GGCTTCATCTTCTGGGGCGTCGCCTACTTCCGCATGCGTAACGCCGATCTCGCCGCCGGGTTCCGCCGTCGGCCC
TTGGCAGACATGTTTTCCATAGGTCTCAACGTCGTCATCATCCTCACTGGCCTCTTCTTCCTCACCGTCGGCACC
TACGCCAGCGTCCAGGGAATCGCTGACGCTTTCCGTGCCGGCGAGGTCGGTGGCGTCTTTTCCTGCAAGAGCAAC
GGCGTCTGA
Gene >Ophio5|2916
ATGGACCGACAACCTTCCGCCCCAGAGAAGCCCTTGGGGCCAAACCCTCCCGGACAACAACAGACAACAGCATCC
CGCACCTTCAGCGGAACCTCATCAACCTCACCGCCCCCGCTCACGCCTCCACGCCGAGGCCGGCGTCGCGCCATG
GTAGGAGCCTGCGTCCTAGGCGGCGCAGGAGTCACCATCGGACCACGAATCACGGCATTACCAGAATGGCTCAAG
GACGAGAACGCAGCAGCGGCAGCAGCGGCAGCAGCAGCAGGCTCATCATCAGACGACGACGTCGATAACGACGCG
AGTAACGCAATCGTCAACAGACAACTCGCTTCCGAAACCGGTCGATCGATTCAATATCGTACCTGCAGCTGGCAG
AAGACGGCGGCCTTACTATTCAGCGAGTATATCTGTTTGGCCATTATGAGCTTTCCTTGGTCATATAGTTTCCTA
GGACTTGTGCCGGGTTTGATTCTTACCGTTGTCATCGCTGCTGTCGTTCTTTACACTAGCTTGGTCTTGTGGCAG
CTTTGCTTGAGGCATCCTGAAGTTCGGGACGTTTGTGATCTCGGTCAGATGTTGTTTTGGCAAAAACCTTGGGCT
TGGTGGGCCACAGCCATCATGTTCGTTCTGAACAACACTTTTATCCAGGGTTTACACGTCCTCGTCGGAGCAGAA
TATCTCAACACCATGACCGAGTCGCGTATCATTACTGGCTGTCGAACCGTTCAGTTTTCTCTCGTCGTCACCATC
GTCTGCTGGCTCGCTTCGTTACCGCGCACATTCAGCATGCTGTCTAAGCTGGGCACCGCCGCCGCCTTCTTCACC
TTTGTGGCTGTCATCCTAGCGACCGTCTTTGCTGCTGTCCAGCCTCAGCCTGCGGGGTACGATCCGGCAAAGGGT
ATGCCGCGATGGACTGCGTTGCCGGTCCATAGCACCACCTTTGTTCAGGGCATGGCTGCCTTTCTCAACATCAGC
TACACCTTTATCGGGCAGATTACCCTGCCCAGCTTCATCGCCGAGATGCGTGACCCACGGTGAGCAATTCGTTTG
TTGAGATGCCGAGTTCAAGAAGCCCGCTGACCTTGTTCTCAGCGAGTTCCCCAAGTCTCTCTGGGCTTGCACCGT
GGCGGAAATCATCACCTTTAGCATTGTCGGCGCCGTCATCTACGTCTATACCGGGAACCAATACGTCAAGTCTCC
GGCTTTTGGCTCTCTCGAAGACCTCTACAAGAAGGTGTCCTTTTCCTTCATGATCCCTACCATCATCTTTCTCGG
CTGCCTGTACGCTTCTGTCACGGCTCGCTTCGTCTTCTTTCGCGTCTTTCGCGGCTCGCGACACCTTAACGACCA
CACCGTCGTCGGCTGGGCATGCTGGGGTGGCATCCTGCTGTGCACCTGGATCATGGCCTTTTTGATTTCCCAGCT
GATTCCCTTCTTCTCGTCCCGTAAGTTGTCTCTCCCCTTTGCTGTCGTCCCATCTTCTCCGGCTCACCTCCACAG
TACTGTCTGTCATGTCATCCCTCTTCGACAGCTGGTTCGGCTTCATCTTCTGGGGCGTCGCCTACTTCCGCATGC
GTAACGCCGATCTCGCCGCCGGGTTCCGCCGTCGGCCCTTGGCAGACATGTTTTCCATAGGTCTCAACGTCGTCA
TCATCCTCACTGGCCTCTTCTTCCTCACCGTCGGCACCTACGCCAGCGTCCAGGGAATCGCTGACGCTTTCCGTG
CCGGCGAGGTCGGTGGCGTCTTTTCCTGCAAGAGCAACGGCGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail