Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2915
Gene name
Locationscaffold_232:15695..17049
Strand-
Gene length (bp)1354
Transcript length (bp)1296
Coding sequence length (bp)1293
Protein length (aa) 431

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08426 ICE2 ICE2 3.7E-153 7 420

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13909|YDW1_SCHPO Uncharacterized protein C23C11.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23C11.01 PE=4 SV=1 1 431 2.0E-54
sp|P40499|ICE2_YEAST Protein ICE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ICE2 PE=1 SV=1 13 419 4.0E-41

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 2 24 22
2 34 53 19
3 66 88 22
4 139 161 22
5 174 196 22
6 206 225 19
7 232 249 17
8 302 324 22
9 358 380 22
10 400 422 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2915
MWWLFSVLLGFVFLLSIVLSIPVAFDVGGRDSGLAYSLSLFIYYLAYSAIRIATSDGSRFGRSVSAALRLSQWIV
IPALMIWALGQFAVDAGSTDWVERTVGGVFRSKSTTWTGWLFGKDGVLETVMLGIWDSCLKYSGPMFQLIEGFCT
LLVIQAAGQITRWLVNRGRSDTWLIILLALSGSIMASSIYFLWRVIQFPQIGNLDATLIGIAMTTAIFLCAYGIG
SGRGNPVESSLLFAYVVLCIYQIFTDYQPSDGTGQADDQAAAQPDIPPLPPIIMASYSTLLHMVGSLPSALHSSL
ALLYAAFQTITPSVIISLMYRLLVFYSATRIIPSVRDLGARALTHEPDFEDSETANKVLGLLSWFSPSILVAVYT
SLLLQHFSTNDGPDGWTLRGGDVGGSTWRWINVGLTMFLYGIELYLIDEQEHWKAD
Coding >Ophio5|2915
ATGTGGTGGCTATTCAGCGTCCTGCTCGGCTTCGTCTTCCTCCTCAGCATCGTCCTTTCCATCCCCGTCGCCTTC
GATGTCGGCGGTCGCGACAGCGGGCTGGCTTACAGCCTGTCGCTCTTCATCTACTACCTCGCCTATTCGGCCATC
CGCATCGCCACCTCGGATGGGTCTCGCTTCGGACGGTCCGTGTCGGCAGCCCTGCGCCTGTCGCAATGGATCGTT
ATCCCGGCGCTGATGATCTGGGCTCTCGGCCAGTTTGCCGTCGACGCGGGGAGCACCGACTGGGTAGAGAGGACT
GTCGGCGGCGTCTTTCGCTCCAAAAGCACCACCTGGACTGGTTGGCTGTTTGGCAAGGACGGTGTACTGGAGACG
GTCATGCTGGGCATATGGGACAGCTGCCTCAAGTATTCGGGGCCCATGTTCCAACTGATCGAAGGCTTTTGCACC
CTGCTGGTCATCCAGGCCGCAGGGCAAATTACCCGCTGGCTCGTCAACCGGGGGAGGAGTGACACCTGGCTGATT
ATCCTCCTCGCTCTATCAGGCTCCATTATGGCCAGCTCCATATATTTCCTGTGGCGCGTCATTCAATTCCCACAG
ATTGGCAATCTGGACGCCACCCTCATCGGCATCGCCATGACGACGGCCATCTTCCTCTGCGCCTACGGAATCGGC
AGCGGCCGAGGCAACCCGGTCGAGAGCTCACTATTGTTTGCCTACGTCGTCCTCTGCATCTACCAGATTTTTACC
GACTACCAACCGTCGGACGGAACCGGGCAGGCCGACGACCAGGCTGCGGCGCAGCCGGACATTCCGCCGCTGCCG
CCCATCATCATGGCGTCATACTCGACGCTACTGCACATGGTCGGCTCGCTGCCCTCGGCGCTACACTCGTCCCTG
GCGCTGTTGTACGCGGCCTTTCAGACGATCACGCCGTCGGTCATCATCTCGCTCATGTACCGGCTCCTCGTCTTC
TACTCGGCCACGCGCATCATCCCCTCGGTGCGGGACCTGGGCGCCCGGGCGCTGACGCATGAGCCGGACTTTGAG
GACTCGGAGACGGCCAACAAGGTGCTGGGCCTCCTGAGCTGGTTCTCGCCGTCGATCCTGGTGGCTGTCTACACG
AGCCTGCTTCTGCAGCACTTTTCGACAAACGACGGACCCGACGGCTGGACGCTCCGTGGCGGCGACGTCGGCGGT
AGCACGTGGCGCTGGATCAACGTCGGCCTGACCATGTTTCTCTACGGCATCGAGCTCTATCTTATCGACGAGCAG
GAACACTGGAAGGCGGAT
Transcript >Ophio5|2915
ATGTGGTGGCTATTCAGCGTCCTGCTCGGCTTCGTCTTCCTCCTCAGCATCGTCCTTTCCATCCCCGTCGCCTTC
GATGTCGGCGGTCGCGACAGCGGGCTGGCTTACAGCCTGTCGCTCTTCATCTACTACCTCGCCTATTCGGCCATC
CGCATCGCCACCTCGGATGGGTCTCGCTTCGGACGGTCCGTGTCGGCAGCCCTGCGCCTGTCGCAATGGATCGTT
ATCCCGGCGCTGATGATCTGGGCTCTCGGCCAGTTTGCCGTCGACGCGGGGAGCACCGACTGGGTAGAGAGGACT
GTCGGCGGCGTCTTTCGCTCCAAAAGCACCACCTGGACTGGTTGGCTGTTTGGCAAGGACGGTGTACTGGAGACG
GTCATGCTGGGCATATGGGACAGCTGCCTCAAGTATTCGGGGCCCATGTTCCAACTGATCGAAGGCTTTTGCACC
CTGCTGGTCATCCAGGCCGCAGGGCAAATTACCCGCTGGCTCGTCAACCGGGGGAGGAGTGACACCTGGCTGATT
ATCCTCCTCGCTCTATCAGGCTCCATTATGGCCAGCTCCATATATTTCCTGTGGCGCGTCATTCAATTCCCACAG
ATTGGCAATCTGGACGCCACCCTCATCGGCATCGCCATGACGACGGCCATCTTCCTCTGCGCCTACGGAATCGGC
AGCGGCCGAGGCAACCCGGTCGAGAGCTCACTATTGTTTGCCTACGTCGTCCTCTGCATCTACCAGATTTTTACC
GACTACCAACCGTCGGACGGAACCGGGCAGGCCGACGACCAGGCTGCGGCGCAGCCGGACATTCCGCCGCTGCCG
CCCATCATCATGGCGTCATACTCGACGCTACTGCACATGGTCGGCTCGCTGCCCTCGGCGCTACACTCGTCCCTG
GCGCTGTTGTACGCGGCCTTTCAGACGATCACGCCGTCGGTCATCATCTCGCTCATGTACCGGCTCCTCGTCTTC
TACTCGGCCACGCGCATCATCCCCTCGGTGCGGGACCTGGGCGCCCGGGCGCTGACGCATGAGCCGGACTTTGAG
GACTCGGAGACGGCCAACAAGGTGCTGGGCCTCCTGAGCTGGTTCTCGCCGTCGATCCTGGTGGCTGTCTACACG
AGCCTGCTTCTGCAGCACTTTTCGACAAACGACGGACCCGACGGCTGGACGCTCCGTGGCGGCGACGTCGGCGGT
AGCACGTGGCGCTGGATCAACGTCGGCCTGACCATGTTTCTCTACGGCATCGAGCTCTATCTTATCGACGAGCAG
GAACACTGGAAGGCGGATTGA
Gene >Ophio5|2915
ATGTGGTGGCTATTCAGCGTCCTGCTCGGCTTCGTCTTCCTCCTCAGCATCGTCCTTTCCATCCCCGTCGCCTTC
GATGTCGGCGGTCGCGACAGCGGGCTGGCTTACAGCCTGTCGCTCTTCATCTACTACCTCGCCTATTCGGCCATC
CGCATCGCCACCTCGGATGGGTCTCGCTTCGGACGGTCCGTGTCGGCAGCCCTGCGCCTGTCGCAATGGATCGTT
ATCCCGGCGCTGATGATCTGGGCTCTCGGCCAGTTTGCCGTCGACGCGGGGAGCACCGACTGGGTAGAGAGGACT
GTCGGCGGCGTCTTTCGCTCCAAAAGCACCACCTGGACTGGTTGGCTGTTTGGCAAGGACGGTGTACTGGAGACG
GTCATGCTGGGCATATGGGACAGCTGCCTCAAGTATTCGGGGCCCATGTTCCAACTGATCGAAGGCTTTTGCACC
CTGCTGGTCATCCAGGCCGCAGGGCAAATTACCCGCTGGCTCGTCAACCGGGGGAGGAGTGACACCTGGCTGGTG
AGCGGTGCCATACATGCTCCCTCTTGATACTTCTTTCAAAACTGATAGCACGCAGATTATCCTCCTCGCTCTATC
AGGCTCCATTATGGCCAGCTCCATATATTTCCTGTGGCGCGTCATTCAATTCCCACAGATTGGCAATCTGGACGC
CACCCTCATCGGCATCGCCATGACGACGGCCATCTTCCTCTGCGCCTACGGAATCGGCAGCGGCCGAGGCAACCC
GGTCGAGAGCTCACTATTGTTTGCCTACGTCGTCCTCTGCATCTACCAGATTTTTACCGACTACCAACCGTCGGA
CGGAACCGGGCAGGCCGACGACCAGGCTGCGGCGCAGCCGGACATTCCGCCGCTGCCGCCCATCATCATGGCGTC
ATACTCGACGCTACTGCACATGGTCGGCTCGCTGCCCTCGGCGCTACACTCGTCCCTGGCGCTGTTGTACGCGGC
CTTTCAGACGATCACGCCGTCGGTCATCATCTCGCTCATGTACCGGCTCCTCGTCTTCTACTCGGCCACGCGCAT
CATCCCCTCGGTGCGGGACCTGGGCGCCCGGGCGCTGACGCATGAGCCGGACTTTGAGGACTCGGAGACGGCCAA
CAAGGTGCTGGGCCTCCTGAGCTGGTTCTCGCCGTCGATCCTGGTGGCTGTCTACACGAGCCTGCTTCTGCAGCA
CTTTTCGACAAACGACGGACCCGACGGCTGGACGCTCCGTGGCGGCGACGTCGGCGGTAGCACGTGGCGCTGGAT
CAACGTCGGCCTGACCATGTTTCTCTACGGCATCGAGCTCTATCTTATCGACGAGCAGGAACACTGGAAGGCGGA
TTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail