Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2905
Gene name
Locationscaffold_231:21736..22831
Strand-
Gene length (bp)1095
Transcript length (bp)1095
Coding sequence length (bp)1092
Protein length (aa) 364

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00011 HSP20 Hsp20/alpha crystallin family 1.1E-08 251 363

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14368|HSP16_SCHPO Heat shock protein 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsp16 PE=1 SV=1 243 357 1.0E-07
sp|Q9LNW0|HS178_ARATH 17.8 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP17.8 PE=1 SV=1 247 363 5.0E-07
sp|Q4UKR8|HSPC2_RICFE Small heat shock protein C2 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=hspC2 PE=3 SV=1 242 364 8.0E-07
sp|Q12329|HSP42_YEAST Heat shock protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSP42 PE=1 SV=1 243 364 8.0E-07
sp|Q9XIE3|HS17A_ARATH 17.6 kDa class I heat shock protein 1 OS=Arabidopsis thaliana GN=HSP17.6A PE=1 SV=1 247 363 2.0E-06

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5944 0.5329 0.4493 0.0371 0.1978 0.0439 0.3114 0.1155 0.0347 0.0358

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6836
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|4318
Ophiocordyceps camponoti-floridani Ophcf2|00362
Ophiocordyceps camponoti-rufipedis Ophun1|4016
Ophiocordyceps kimflemingae Ophio5|2905 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2905
MASQDNPWVPFNLLHLPDPSRDPGRGVDHSNPPAGPRNPFSFMTGPAAAAAAAAAASSWAGWGPDGDQGPFGRRR
HRHHHHHHHHGFRNRGGFGRRPNDRDPFRAAGDDVDGDAAAMEGLAATDETDTNVPDPAEVTPDEDDDDDDGDGG
GGGGSVPPPPPPPQQQQQQQQQPPRRLDPFCRRRGPRHNDDFTATSLPTLLRNLMNSPMLQSPSRDQPTQRPNPS
STTSAAEADADAGDMMNFTPPVDVYSTATAYIVHMSLPGARKSDVGVDWDPHRASLRVAGVLHRPGDESDLAALV
SAERRVGFFDRSVPLPPLDTAAPADADVAVDAAAITAKMEHGILVVVVPKLEKEKAQVRRVEIE
Coding >Ophio5|2905
ATGGCTTCGCAAGACAACCCGTGGGTACCGTTCAACCTCCTTCACTTGCCCGACCCATCCCGCGACCCCGGCCGT
GGCGTGGATCACAGCAACCCACCGGCGGGGCCCCGGAACCCGTTCAGCTTTATGACGGGTCCCGCCGCCGCCGCC
GCCGCCGCCGCCGCCGCATCCTCTTGGGCCGGCTGGGGCCCGGACGGCGACCAAGGTCCGTTTGGCCGCCGCCGC
CACCGTCACCACCACCACCACCACCACCACGGCTTTCGCAACCGCGGCGGCTTCGGACGTCGGCCAAACGACAGG
GACCCTTTTCGTGCTGCCGGCGACGACGTAGACGGAGATGCTGCTGCCATGGAGGGCTTGGCTGCTACCGACGAG
ACGGATACCAACGTCCCTGACCCCGCTGAGGTAACGCCTGATGAGGACGATGATGACGACGACGGCGACGGCGGT
GGTGGTGGTGGCAGTGTGCCGCCGCCGCCGCCGCCGCCGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCACCTCGT
CGACTGGACCCCTTCTGTCGACGTCGCGGACCTCGTCACAACGACGACTTCACCGCAACCTCCCTACCGACCCTA
CTACGCAACCTGATGAACAGCCCCATGCTCCAAAGCCCAAGCCGCGACCAGCCCACCCAACGGCCGAACCCCTCC
TCCACCACCTCAGCCGCAGAGGCCGACGCCGACGCCGGGGACATGATGAACTTCACGCCCCCCGTCGACGTCTAC
AGCACCGCCACCGCCTACATCGTCCACATGTCCCTTCCCGGCGCCCGCAAGTCCGACGTCGGCGTCGATTGGGAT
CCGCATCGCGCTAGTCTGCGCGTCGCCGGCGTCCTTCACCGCCCTGGCGACGAGTCTGACCTCGCTGCCCTCGTC
TCCGCTGAGCGTCGCGTCGGCTTCTTTGATCGCTCTGTGCCTCTTCCCCCCCTTGACACGGCCGCTCCCGCTGAT
GCTGATGTCGCCGTTGACGCGGCTGCTATCACGGCTAAGATGGAGCATGGCATTCTTGTCGTTGTTGTGCCCAAG
CTGGAGAAGGAAAAGGCCCAAGTTCGACGGGTTGAAATCGAG
Transcript >Ophio5|2905
ATGGCTTCGCAAGACAACCCGTGGGTACCGTTCAACCTCCTTCACTTGCCCGACCCATCCCGCGACCCCGGCCGT
GGCGTGGATCACAGCAACCCACCGGCGGGGCCCCGGAACCCGTTCAGCTTTATGACGGGTCCCGCCGCCGCCGCC
GCCGCCGCCGCCGCCGCATCCTCTTGGGCCGGCTGGGGCCCGGACGGCGACCAAGGTCCGTTTGGCCGCCGCCGC
CACCGTCACCACCACCACCACCACCACCACGGCTTTCGCAACCGCGGCGGCTTCGGACGTCGGCCAAACGACAGG
GACCCTTTTCGTGCTGCCGGCGACGACGTAGACGGAGATGCTGCTGCCATGGAGGGCTTGGCTGCTACCGACGAG
ACGGATACCAACGTCCCTGACCCCGCTGAGGTAACGCCTGATGAGGACGATGATGACGACGACGGCGACGGCGGT
GGTGGTGGTGGCAGTGTGCCGCCGCCGCCGCCGCCGCCGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCACCTCGT
CGACTGGACCCCTTCTGTCGACGTCGCGGACCTCGTCACAACGACGACTTCACCGCAACCTCCCTACCGACCCTA
CTACGCAACCTGATGAACAGCCCCATGCTCCAAAGCCCAAGCCGCGACCAGCCCACCCAACGGCCGAACCCCTCC
TCCACCACCTCAGCCGCAGAGGCCGACGCCGACGCCGGGGACATGATGAACTTCACGCCCCCCGTCGACGTCTAC
AGCACCGCCACCGCCTACATCGTCCACATGTCCCTTCCCGGCGCCCGCAAGTCCGACGTCGGCGTCGATTGGGAT
CCGCATCGCGCTAGTCTGCGCGTCGCCGGCGTCCTTCACCGCCCTGGCGACGAGTCTGACCTCGCTGCCCTCGTC
TCCGCTGAGCGTCGCGTCGGCTTCTTTGATCGCTCTGTGCCTCTTCCCCCCCTTGACACGGCCGCTCCCGCTGAT
GCTGATGTCGCCGTTGACGCGGCTGCTATCACGGCTAAGATGGAGCATGGCATTCTTGTCGTTGTTGTGCCCAAG
CTGGAGAAGGAAAAGGCCCAAGTTCGACGGGTTGAAATCGAGTGA
Gene >Ophio5|2905
ATGGCTTCGCAAGACAACCCGTGGGTACCGTTCAACCTCCTTCACTTGCCCGACCCATCCCGCGACCCCGGCCGT
GGCGTGGATCACAGCAACCCACCGGCGGGGCCCCGGAACCCGTTCAGCTTTATGACGGGTCCCGCCGCCGCCGCC
GCCGCCGCCGCCGCCGCATCCTCTTGGGCCGGCTGGGGCCCGGACGGCGACCAAGGTCCGTTTGGCCGCCGCCGC
CACCGTCACCACCACCACCACCACCACCACGGCTTTCGCAACCGCGGCGGCTTCGGACGTCGGCCAAACGACAGG
GACCCTTTTCGTGCTGCCGGCGACGACGTAGACGGAGATGCTGCTGCCATGGAGGGCTTGGCTGCTACCGACGAG
ACGGATACCAACGTCCCTGACCCCGCTGAGGTAACGCCTGATGAGGACGATGATGACGACGACGGCGACGGCGGT
GGTGGTGGTGGCAGTGTGCCGCCGCCGCCGCCGCCGCCGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCACCTCGT
CGACTGGACCCCTTCTGTCGACGTCGCGGACCTCGTCACAACGACGACTTCACCGCAACCTCCCTACCGACCCTA
CTACGCAACCTGATGAACAGCCCCATGCTCCAAAGCCCAAGCCGCGACCAGCCCACCCAACGGCCGAACCCCTCC
TCCACCACCTCAGCCGCAGAGGCCGACGCCGACGCCGGGGACATGATGAACTTCACGCCCCCCGTCGACGTCTAC
AGCACCGCCACCGCCTACATCGTCCACATGTCCCTTCCCGGCGCCCGCAAGTCCGACGTCGGCGTCGATTGGGAT
CCGCATCGCGCTAGTCTGCGCGTCGCCGGCGTCCTTCACCGCCCTGGCGACGAGTCTGACCTCGCTGCCCTCGTC
TCCGCTGAGCGTCGCGTCGGCTTCTTTGATCGCTCTGTGCCTCTTCCCCCCCTTGACACGGCCGCTCCCGCTGAT
GCTGATGTCGCCGTTGACGCGGCTGCTATCACGGCTAAGATGGAGCATGGCATTCTTGTCGTTGTTGTGCCCAAG
CTGGAGAAGGAAAAGGCCCAAGTTCGACGGGTTGAAATCGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail