Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2901
Gene name
Locationscaffold_231:3955..4879
Strand-
Gene length (bp)924
Transcript length (bp)873
Coding sequence length (bp)870
Protein length (aa) 290

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06912 DUF1275 Protein of unknown function (DUF1275) 7.2E-44 70 274

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 116 135 19
2 148 167 19
3 177 196 19
4 236 253 17
5 257 279 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 25.13 10.35 39.90
CcL In ants, during behavior modification 25.69 10.55 40.84
CcD In ants, recently dead 22.45 9.06 35.85

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.954182 no
SC16a CcD 0.751155 no
CcL CcD 0.695907 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2901
MFCHLPLRIAKHDTTAGEKNSRTPEPVPQEISSEASAGSYWPVVAVPERGRLLSHFTEDVRSSLFAEAQLVLLTF
CTGIQDVTTFLDYHCFASNQTGNTVFLCIALIISKIESETFVTANIGMSLGVFLGAGWLTGQLSHAIGPRKRWWL
VLSNLVQTVFVFGVAGIQYRYGNADRGPVALGVVALLAFAAGSQVVQSRSLRMTEISTAMATAAWVDLVIDPKLF
VLHNRPRNRRVAFLAALAVGSLIGAVVYRQVGSAAVMAVSGAGKLLVTVLFLFSPAEMQRRTEAV
Coding >Ophio5|2901
ATGTTTTGCCACTTGCCTCTTCGCATCGCGAAGCATGACACGACGGCTGGGGAAAAGAACTCGAGGACTCCCGAG
CCAGTTCCTCAGGAGATCTCGTCCGAAGCGAGCGCCGGCTCCTACTGGCCCGTCGTCGCCGTACCCGAGCGGGGC
AGGCTTCTGAGCCACTTCACCGAGGATGTCCGCTCCTCACTCTTTGCCGAGGCACAGCTCGTGCTCTTGACATTT
TGTACCGGCATTCAAGATGTCACCACCTTTCTCGACTATCATTGCTTCGCCTCCAACCAGACCGGGAACACCGTC
TTTCTCTGCATCGCTCTGATCATCTCCAAGATCGAGAGCGAGACGTTTGTGACGGCAAATATCGGCATGTCTTTG
GGTGTGTTCCTGGGCGCCGGATGGTTGACGGGGCAGCTGAGCCACGCAATCGGACCTCGAAAGCGTTGGTGGCTC
GTCTTAAGCAATCTGGTCCAGACCGTCTTCGTCTTCGGCGTCGCTGGAATCCAGTACCGGTACGGGAATGCCGAT
CGCGGACCGGTCGCTCTCGGCGTCGTGGCCCTGCTGGCCTTTGCCGCCGGCAGCCAAGTCGTCCAGTCGCGCAGC
CTGCGCATGACTGAAATCAGCACGGCCATGGCCACGGCCGCATGGGTGGACCTGGTCATCGACCCGAAGCTCTTT
GTACTGCACAATCGCCCGAGGAATCGTCGTGTCGCCTTCCTCGCCGCTCTGGCCGTCGGCTCCCTCATCGGCGCC
GTGGTCTACCGGCAGGTTGGTTCGGCAGCTGTCATGGCCGTGTCTGGAGCCGGCAAGCTGCTCGTCACCGTACTC
TTCCTGTTTTCACCCGCTGAGATGCAACGACGGACCGAGGCAGTG
Transcript >Ophio5|2901
ATGTTTTGCCACTTGCCTCTTCGCATCGCGAAGCATGACACGACGGCTGGGGAAAAGAACTCGAGGACTCCCGAG
CCAGTTCCTCAGGAGATCTCGTCCGAAGCGAGCGCCGGCTCCTACTGGCCCGTCGTCGCCGTACCCGAGCGGGGC
AGGCTTCTGAGCCACTTCACCGAGGATGTCCGCTCCTCACTCTTTGCCGAGGCACAGCTCGTGCTCTTGACATTT
TGTACCGGCATTCAAGATGTCACCACCTTTCTCGACTATCATTGCTTCGCCTCCAACCAGACCGGGAACACCGTC
TTTCTCTGCATCGCTCTGATCATCTCCAAGATCGAGAGCGAGACGTTTGTGACGGCAAATATCGGCATGTCTTTG
GGTGTGTTCCTGGGCGCCGGATGGTTGACGGGGCAGCTGAGCCACGCAATCGGACCTCGAAAGCGTTGGTGGCTC
GTCTTAAGCAATCTGGTCCAGACCGTCTTCGTCTTCGGCGTCGCTGGAATCCAGTACCGGTACGGGAATGCCGAT
CGCGGACCGGTCGCTCTCGGCGTCGTGGCCCTGCTGGCCTTTGCCGCCGGCAGCCAAGTCGTCCAGTCGCGCAGC
CTGCGCATGACTGAAATCAGCACGGCCATGGCCACGGCCGCATGGGTGGACCTGGTCATCGACCCGAAGCTCTTT
GTACTGCACAATCGCCCGAGGAATCGTCGTGTCGCCTTCCTCGCCGCTCTGGCCGTCGGCTCCCTCATCGGCGCC
GTGGTCTACCGGCAGGTTGGTTCGGCAGCTGTCATGGCCGTGTCTGGAGCCGGCAAGCTGCTCGTCACCGTACTC
TTCCTGTTTTCACCCGCTGAGATGCAACGACGGACCGAGGCAGTGTAA
Gene >Ophio5|2901
ATGTTTTGCCACTTGCCTCTTCGCATCGCGAAGCATGACACGACGGCTGGGGAAAAGAACTCGAGGACTCCCGAG
CCAGTTCCTCAGGAGATCTCGTCCGAAGCGAGCGCCGGCTCCTACTGGCCCGTCGTCGCCGTACCCGAGCGGGGC
AGGCTTCTGAGCCACTTCACCGAGGATGTCCGCTCCTCACTCTTTGCCGAGGCACAGCTCGTGCTCTTGACATTT
TGTACCGGCATTCAAGGTTAGGAGGCACAGGTTAACGTAATATTCCTGAAGCTGACGGCCAGTGCAGATGTCACC
ACCTTTCTCGACTATCATTGCTTCGCCTCCAACCAGACCGGGAACACCGTCTTTCTCTGCATCGCTCTGATCATC
TCCAAGATCGAGAGCGAGACGTTTGTGACGGCAAATATCGGCATGTCTTTGGGTGTGTTCCTGGGCGCCGGATGG
TTGACGGGGCAGCTGAGCCACGCAATCGGACCTCGAAAGCGTTGGTGGCTCGTCTTAAGCAATCTGGTCCAGACC
GTCTTCGTCTTCGGCGTCGCTGGAATCCAGTACCGGTACGGGAATGCCGATCGCGGACCGGTCGCTCTCGGCGTC
GTGGCCCTGCTGGCCTTTGCCGCCGGCAGCCAAGTCGTCCAGTCGCGCAGCCTGCGCATGACTGAAATCAGCACG
GCCATGGCCACGGCCGCATGGGTGGACCTGGTCATCGACCCGAAGCTCTTTGTACTGCACAATCGCCCGAGGAAT
CGTCGTGTCGCCTTCCTCGCCGCTCTGGCCGTCGGCTCCCTCATCGGCGCCGTGGTCTACCGGCAGGTTGGTTCG
GCAGCTGTCATGGCCGTGTCTGGAGCCGGCAAGCTGCTCGTCACCGTACTCTTCCTGTTTTCACCCGCTGAGATG
CAACGACGGACCGAGGCAGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail