Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2901
Gene name
Locationscaffold_231:3955..4879
Strand-
Gene length (bp)924
Transcript length (bp)873
Coding sequence length (bp)870
Protein length (aa) 290

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06912 DUF1275 Protein of unknown function (DUF1275) 7.2E-44 70 274

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 116 135 19
2 148 167 19
3 177 196 19
4 236 253 17
5 257 279 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2901
MFCHLPLRIAKHDTTAGEKNSRTPEPVPQEISSEASAGSYWPVVAVPERGRLLSHFTEDVRSSLFAEAQLVLLTF
CTGIQDVTTFLDYHCFASNQTGNTVFLCIALIISKIESETFVTANIGMSLGVFLGAGWLTGQLSHAIGPRKRWWL
VLSNLVQTVFVFGVAGIQYRYGNADRGPVALGVVALLAFAAGSQVVQSRSLRMTEISTAMATAAWVDLVIDPKLF
VLHNRPRNRRVAFLAALAVGSLIGAVVYRQVGSAAVMAVSGAGKLLVTVLFLFSPAEMQRRTEAV
Coding >Ophio5|2901
ATGTTTTGCCACTTGCCTCTTCGCATCGCGAAGCATGACACGACGGCTGGGGAAAAGAACTCGAGGACTCCCGAG
CCAGTTCCTCAGGAGATCTCGTCCGAAGCGAGCGCCGGCTCCTACTGGCCCGTCGTCGCCGTACCCGAGCGGGGC
AGGCTTCTGAGCCACTTCACCGAGGATGTCCGCTCCTCACTCTTTGCCGAGGCACAGCTCGTGCTCTTGACATTT
TGTACCGGCATTCAAGATGTCACCACCTTTCTCGACTATCATTGCTTCGCCTCCAACCAGACCGGGAACACCGTC
TTTCTCTGCATCGCTCTGATCATCTCCAAGATCGAGAGCGAGACGTTTGTGACGGCAAATATCGGCATGTCTTTG
GGTGTGTTCCTGGGCGCCGGATGGTTGACGGGGCAGCTGAGCCACGCAATCGGACCTCGAAAGCGTTGGTGGCTC
GTCTTAAGCAATCTGGTCCAGACCGTCTTCGTCTTCGGCGTCGCTGGAATCCAGTACCGGTACGGGAATGCCGAT
CGCGGACCGGTCGCTCTCGGCGTCGTGGCCCTGCTGGCCTTTGCCGCCGGCAGCCAAGTCGTCCAGTCGCGCAGC
CTGCGCATGACTGAAATCAGCACGGCCATGGCCACGGCCGCATGGGTGGACCTGGTCATCGACCCGAAGCTCTTT
GTACTGCACAATCGCCCGAGGAATCGTCGTGTCGCCTTCCTCGCCGCTCTGGCCGTCGGCTCCCTCATCGGCGCC
GTGGTCTACCGGCAGGTTGGTTCGGCAGCTGTCATGGCCGTGTCTGGAGCCGGCAAGCTGCTCGTCACCGTACTC
TTCCTGTTTTCACCCGCTGAGATGCAACGACGGACCGAGGCAGTG
Transcript >Ophio5|2901
ATGTTTTGCCACTTGCCTCTTCGCATCGCGAAGCATGACACGACGGCTGGGGAAAAGAACTCGAGGACTCCCGAG
CCAGTTCCTCAGGAGATCTCGTCCGAAGCGAGCGCCGGCTCCTACTGGCCCGTCGTCGCCGTACCCGAGCGGGGC
AGGCTTCTGAGCCACTTCACCGAGGATGTCCGCTCCTCACTCTTTGCCGAGGCACAGCTCGTGCTCTTGACATTT
TGTACCGGCATTCAAGATGTCACCACCTTTCTCGACTATCATTGCTTCGCCTCCAACCAGACCGGGAACACCGTC
TTTCTCTGCATCGCTCTGATCATCTCCAAGATCGAGAGCGAGACGTTTGTGACGGCAAATATCGGCATGTCTTTG
GGTGTGTTCCTGGGCGCCGGATGGTTGACGGGGCAGCTGAGCCACGCAATCGGACCTCGAAAGCGTTGGTGGCTC
GTCTTAAGCAATCTGGTCCAGACCGTCTTCGTCTTCGGCGTCGCTGGAATCCAGTACCGGTACGGGAATGCCGAT
CGCGGACCGGTCGCTCTCGGCGTCGTGGCCCTGCTGGCCTTTGCCGCCGGCAGCCAAGTCGTCCAGTCGCGCAGC
CTGCGCATGACTGAAATCAGCACGGCCATGGCCACGGCCGCATGGGTGGACCTGGTCATCGACCCGAAGCTCTTT
GTACTGCACAATCGCCCGAGGAATCGTCGTGTCGCCTTCCTCGCCGCTCTGGCCGTCGGCTCCCTCATCGGCGCC
GTGGTCTACCGGCAGGTTGGTTCGGCAGCTGTCATGGCCGTGTCTGGAGCCGGCAAGCTGCTCGTCACCGTACTC
TTCCTGTTTTCACCCGCTGAGATGCAACGACGGACCGAGGCAGTGTAA
Gene >Ophio5|2901
ATGTTTTGCCACTTGCCTCTTCGCATCGCGAAGCATGACACGACGGCTGGGGAAAAGAACTCGAGGACTCCCGAG
CCAGTTCCTCAGGAGATCTCGTCCGAAGCGAGCGCCGGCTCCTACTGGCCCGTCGTCGCCGTACCCGAGCGGGGC
AGGCTTCTGAGCCACTTCACCGAGGATGTCCGCTCCTCACTCTTTGCCGAGGCACAGCTCGTGCTCTTGACATTT
TGTACCGGCATTCAAGGTTAGGAGGCACAGGTTAACGTAATATTCCTGAAGCTGACGGCCAGTGCAGATGTCACC
ACCTTTCTCGACTATCATTGCTTCGCCTCCAACCAGACCGGGAACACCGTCTTTCTCTGCATCGCTCTGATCATC
TCCAAGATCGAGAGCGAGACGTTTGTGACGGCAAATATCGGCATGTCTTTGGGTGTGTTCCTGGGCGCCGGATGG
TTGACGGGGCAGCTGAGCCACGCAATCGGACCTCGAAAGCGTTGGTGGCTCGTCTTAAGCAATCTGGTCCAGACC
GTCTTCGTCTTCGGCGTCGCTGGAATCCAGTACCGGTACGGGAATGCCGATCGCGGACCGGTCGCTCTCGGCGTC
GTGGCCCTGCTGGCCTTTGCCGCCGGCAGCCAAGTCGTCCAGTCGCGCAGCCTGCGCATGACTGAAATCAGCACG
GCCATGGCCACGGCCGCATGGGTGGACCTGGTCATCGACCCGAAGCTCTTTGTACTGCACAATCGCCCGAGGAAT
CGTCGTGTCGCCTTCCTCGCCGCTCTGGCCGTCGGCTCCCTCATCGGCGCCGTGGTCTACCGGCAGGTTGGTTCG
GCAGCTGTCATGGCCGTGTCTGGAGCCGGCAAGCTGCTCGTCACCGTACTCTTCCTGTTTTCACCCGCTGAGATG
CAACGACGGACCGAGGCAGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail