Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2900
Gene name
Locationscaffold_231:2556..3633
Strand+
Gene length (bp)1077
Transcript length (bp)1077
Coding sequence length (bp)1074
Protein length (aa) 358

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.1E-08 32 109
PF07690 MFS_1 Major Facilitator Superfamily 1.9E-13 158 339

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P47159|YJ94_YEAST Uncharacterized membrane protein YJR124C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJR124C PE=1 SV=1 1 339 6.0E-51

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 51 73 22
2 88 110 22
3 153 175 22
4 190 212 22
5 280 302 22
6 307 329 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2900
MFGVASNFWILLAAATIGIISPSGNEIGPFRAIEESTLSQLTPAEARADVFAWYNLTGTVGIALGMVVSGWLVSA
AEMREQLSRSDAYRVVFFLYAAVGFTMLLMTLSLSDKCEVQDDESVSEEETPLLRGPGLNHLKKGSLLPRFGPDR
RRLCVTLALLFGLDAFATSLATLSWTADYFKRKFSMPAGHLGSLFFAISILSTASILLAASLARRFGNVKTMVYS
HLPSAFALAFLGIPDSRPLAITLLVIRASSQYMDAAPRSSFLAEVLRPEERTAVMGVINVVKTGVSSFGPIITGV
FVERHLVWAVFLISGILKALYDFSILGAFLNYEPEGESKARGEGGVEETDEAVIEARG
Coding >Ophio5|2900
ATGTTTGGCGTTGCCTCCAACTTTTGGATTTTACTGGCCGCTGCCACCATTGGCATCATCAGCCCGTCGGGTAAC
GAGATCGGTCCGTTTCGCGCAATCGAGGAGTCGACTCTCTCGCAGCTCACGCCCGCCGAAGCCCGTGCCGATGTC
TTTGCCTGGTATAACTTGACGGGCACCGTGGGCATTGCCCTCGGTATGGTCGTCAGCGGCTGGCTGGTCAGCGCG
GCCGAGATGCGCGAGCAATTGAGCCGCAGCGACGCCTATCGCGTCGTCTTCTTTCTCTACGCTGCCGTCGGCTTC
ACCATGCTGCTCATGACGCTGTCCCTGAGCGACAAGTGCGAGGTCCAAGACGACGAATCCGTTTCCGAAGAGGAG
ACTCCCCTCCTACGCGGCCCGGGCCTCAACCACCTGAAGAAGGGATCCCTTTTGCCGCGCTTCGGCCCGGACCGC
CGCCGGCTCTGCGTCACGCTCGCGCTGCTCTTTGGTCTGGACGCCTTCGCTACCAGTCTGGCGACGCTGTCGTGG
ACGGCCGACTACTTCAAGCGCAAGTTCTCCATGCCCGCCGGCCACCTCGGCTCTCTCTTCTTCGCCATCTCCATC
CTCTCCACCGCCTCCATCCTCTTGGCCGCCAGTCTGGCCCGCCGCTTCGGTAACGTCAAGACCATGGTCTATTCC
CACCTGCCGTCCGCCTTCGCCCTCGCTTTCCTCGGCATCCCCGACTCACGGCCCCTGGCCATCACCCTGCTCGTC
ATCCGGGCCAGCTCACAGTACATGGACGCCGCACCGCGCAGCTCCTTTCTAGCAGAGGTTCTGCGTCCGGAGGAA
AGGACGGCGGTGATGGGAGTAATCAACGTGGTCAAGACGGGAGTGTCGAGCTTCGGACCCATCATCACCGGCGTC
TTCGTCGAGCGTCATCTTGTTTGGGCCGTCTTCTTGATCTCTGGCATCCTCAAGGCCTTGTACGACTTCAGCATC
CTCGGTGCCTTTCTCAACTACGAGCCCGAGGGCGAATCCAAGGCGCGTGGGGAGGGCGGTGTCGAGGAGACAGAC
GAAGCAGTAATAGAAGCGAGGGGC
Transcript >Ophio5|2900
ATGTTTGGCGTTGCCTCCAACTTTTGGATTTTACTGGCCGCTGCCACCATTGGCATCATCAGCCCGTCGGGTAAC
GAGATCGGTCCGTTTCGCGCAATCGAGGAGTCGACTCTCTCGCAGCTCACGCCCGCCGAAGCCCGTGCCGATGTC
TTTGCCTGGTATAACTTGACGGGCACCGTGGGCATTGCCCTCGGTATGGTCGTCAGCGGCTGGCTGGTCAGCGCG
GCCGAGATGCGCGAGCAATTGAGCCGCAGCGACGCCTATCGCGTCGTCTTCTTTCTCTACGCTGCCGTCGGCTTC
ACCATGCTGCTCATGACGCTGTCCCTGAGCGACAAGTGCGAGGTCCAAGACGACGAATCCGTTTCCGAAGAGGAG
ACTCCCCTCCTACGCGGCCCGGGCCTCAACCACCTGAAGAAGGGATCCCTTTTGCCGCGCTTCGGCCCGGACCGC
CGCCGGCTCTGCGTCACGCTCGCGCTGCTCTTTGGTCTGGACGCCTTCGCTACCAGTCTGGCGACGCTGTCGTGG
ACGGCCGACTACTTCAAGCGCAAGTTCTCCATGCCCGCCGGCCACCTCGGCTCTCTCTTCTTCGCCATCTCCATC
CTCTCCACCGCCTCCATCCTCTTGGCCGCCAGTCTGGCCCGCCGCTTCGGTAACGTCAAGACCATGGTCTATTCC
CACCTGCCGTCCGCCTTCGCCCTCGCTTTCCTCGGCATCCCCGACTCACGGCCCCTGGCCATCACCCTGCTCGTC
ATCCGGGCCAGCTCACAGTACATGGACGCCGCACCGCGCAGCTCCTTTCTAGCAGAGGTTCTGCGTCCGGAGGAA
AGGACGGCGGTGATGGGAGTAATCAACGTGGTCAAGACGGGAGTGTCGAGCTTCGGACCCATCATCACCGGCGTC
TTCGTCGAGCGTCATCTTGTTTGGGCCGTCTTCTTGATCTCTGGCATCCTCAAGGCCTTGTACGACTTCAGCATC
CTCGGTGCCTTTCTCAACTACGAGCCCGAGGGCGAATCCAAGGCGCGTGGGGAGGGCGGTGTCGAGGAGACAGAC
GAAGCAGTAATAGAAGCGAGGGGCTGA
Gene >Ophio5|2900
ATGTTTGGCGTTGCCTCCAACTTTTGGATTTTACTGGCCGCTGCCACCATTGGCATCATCAGCCCGTCGGGTAAC
GAGATCGGTCCGTTTCGCGCAATCGAGGAGTCGACTCTCTCGCAGCTCACGCCCGCCGAAGCCCGTGCCGATGTC
TTTGCCTGGTATAACTTGACGGGCACCGTGGGCATTGCCCTCGGTATGGTCGTCAGCGGCTGGCTGGTCAGCGCG
GCCGAGATGCGCGAGCAATTGAGCCGCAGCGACGCCTATCGCGTCGTCTTCTTTCTCTACGCTGCCGTCGGCTTC
ACCATGCTGCTCATGACGCTGTCCCTGAGCGACAAGTGCGAGGTCCAAGACGACGAATCCGTTTCCGAAGAGGAG
ACTCCCCTCCTACGCGGCCCGGGCCTCAACCACCTGAAGAAGGGATCCCTTTTGCCGCGCTTCGGCCCGGACCGC
CGCCGGCTCTGCGTCACGCTCGCGCTGCTCTTTGGTCTGGACGCCTTCGCTACCAGTCTGGCGACGCTGTCGTGG
ACGGCCGACTACTTCAAGCGCAAGTTCTCCATGCCCGCCGGCCACCTCGGCTCTCTCTTCTTCGCCATCTCCATC
CTCTCCACCGCCTCCATCCTCTTGGCCGCCAGTCTGGCCCGCCGCTTCGGTAACGTCAAGACCATGGTCTATTCC
CACCTGCCGTCCGCCTTCGCCCTCGCTTTCCTCGGCATCCCCGACTCACGGCCCCTGGCCATCACCCTGCTCGTC
ATCCGGGCCAGCTCACAGTACATGGACGCCGCACCGCGCAGCTCCTTTCTAGCAGAGGTTCTGCGTCCGGAGGAA
AGGACGGCGGTGATGGGAGTAATCAACGTGGTCAAGACGGGAGTGTCGAGCTTCGGACCCATCATCACCGGCGTC
TTCGTCGAGCGTCATCTTGTTTGGGCCGTCTTCTTGATCTCTGGCATCCTCAAGGCCTTGTACGACTTCAGCATC
CTCGGTGCCTTTCTCAACTACGAGCCCGAGGGCGAATCCAAGGCGCGTGGGGAGGGCGGTGTCGAGGAGACAGAC
GAAGCAGTAATAGAAGCGAGGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail