Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2897
Gene name
Locationscaffold_230:22428..28119
Strand+
Gene length (bp)5691
Transcript length (bp)5580
Coding sequence length (bp)5577
Protein length (aa) 1859

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12830 Nipped-B_C Sister chromatid cohesion C-terminus 1.3E-46 1434 1622
PF12765 Cohesin_HEAT HEAT repeat associated with sister chromatid cohesion 3.2E-06 958 999

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00333|NPBL_COPC7 Protein rad9 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=rad9 PE=2 SV=2 439 1788 1.0E-75
sp|Q09725|MIS4_SCHPO Sister chromatid cohesion protein mis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mis4 PE=1 SV=2 516 1631 1.0E-57
sp|Q6KCD5|NIPBL_MOUSE Nipped-B-like protein OS=Mus musculus GN=Nipbl PE=1 SV=1 433 1642 7.0E-45
sp|Q6KC79|NIPBL_HUMAN Nipped-B-like protein OS=Homo sapiens GN=NIPBL PE=1 SV=2 433 1642 8.0E-44
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 430 1639 1.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00333|NPBL_COPC7 Protein rad9 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=rad9 PE=2 SV=2 439 1788 1.0E-75
sp|Q09725|MIS4_SCHPO Sister chromatid cohesion protein mis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mis4 PE=1 SV=2 516 1631 1.0E-57
sp|Q6KCD5|NIPBL_MOUSE Nipped-B-like protein OS=Mus musculus GN=Nipbl PE=1 SV=1 433 1642 7.0E-45
sp|Q6KC79|NIPBL_HUMAN Nipped-B-like protein OS=Homo sapiens GN=NIPBL PE=1 SV=2 433 1642 8.0E-44
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 430 1639 1.0E-38
sp|F5HSE3|NIPLA_DANRE Nipped-B-like protein A OS=Danio rerio GN=nipbla PE=2 SV=1 388 1641 1.0E-35
sp|Q95XZ5|NPBL_CAEEL Nipped-B-like protein pqn-85 OS=Caenorhabditis elegans GN=pqn-85 PE=3 SV=2 433 1487 7.0E-25
sp|Q750S2|SCC2_ASHGO Sister chromatid cohesion protein 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SCC2 PE=1 SV=1 522 1497 8.0E-24
sp|Q04002|SCC2_YEAST Sister chromatid cohesion protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCC2 PE=1 SV=1 363 1526 2.0E-15
sp|Q7PLI2|NIPB_DROME Nipped-B protein OS=Drosophila melanogaster GN=Nipped-B PE=1 SV=3 904 1561 2.0E-14
sp|Q7PLI2|NIPB_DROME Nipped-B protein OS=Drosophila melanogaster GN=Nipped-B PE=1 SV=3 433 790 3.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2897
MLPRGANGPTNGVDMLQPPPQPHPAISRPFTLQESLPYSPQTSTAPLLPDVIPDPTLGSGSPALPISGLFPRDEF
DRVNAEALNHPQGSRTLKQAADYVLHDLKPSQRTQYKFSAIPPGPPGPPPSKSLSHGLSPMTRSVYDRVGSFFKS
TKANIAGPKANGEVHQLPKSTKESPSLSSRAPSYAQDRRSENPQAYRSPSCRIEVAIPSKKTFDPSSYIDVATSG
PPLESIPHSIPQELPAKVKLPSSNNGNAVIKEQSPSGGKNLAFSIELPKANIKKEEYLEVCEVPDAPRSLSTRRP
ETQDVAHSQGVTVTSLDQRQRSEVALDALDALFRSIFAAVGSALAMEPGSEHIVTLKADHEPAMTSATQQKLHGA
IQKIIDLRCFESVALENLLQIIKLSDSSLRQVESLEFRVDESWDEGAVDSWVQQLSEVETALKAARTCLRLLSGG
REDRQLYSESTIQRCVDLFKSVTEDLVIPLVELRNSGPAASLFKLVQKHKKAVSSTFVCCQKLFAILAELVTKIE
FSESVINTLEYTSSKLIFVENAYFEKDSAIGPQRFDGIRSVAMDMLCQIFLIKPEQRQGIIDDILTSLEKLPVGK
QSSRQFKLSDGGSIQPVSALIMRLVQASSGRVNVDDGSGRAAILQRINGTDTGPGEGSAASKKSQAPYTVTTEDV
GAQQHAVAVQELKASAVPLTDAASRNASYVINFIVKRAIGSTKTGDTPYRNLLDLFVDDFTTCLDSPDWPSAELL
LRLLMFMMVQLFEAGKTAAPAKNMALELLGAMSAAISRLRSHVKKTAGLFEGSDASELSQYLSELAILVLEQKSQ
MEHISTWSGPYRVSLEHLQERCSDDPHLAGAASYMSTDWANKIHVAYDTVQEGDKERDQELGRLAYRLRMMIEDR
KWLSSQYTFKAVSASQARFAYSIILLRSPLCEAFGKIVNILLGSMASDQATVRSKSLKSIHQVLETDPSILDGDS
TVIQLILDCASDSSTQVRDSALGLLGNCIGMRRALESSLTPRIIERFQDAGVGVRKRAMKLARDIYLRNRSKTLR
SAIANGLLRRAQDPDEGVRDLSRQMIEEVWFAPFYSNENTAAFETSLAEHVALIIQTVKTGTVTEVLDKVFQTVL
RPQNRSLEGPFSVCSRLVGTMFGMIDNPDSEDTTVPSGRDALQVLTIFAKADPKLFNFEQIRLLKPQLASFSGRD
ELAAFRAVTVIYKRVLPQLPMVHAEFLADVRLQLLKAIGKIFSRVALDDLIACTQVVCELLRDFSPLANLVASSL
LGIQKLGKDTLDKRGLGQLCAYAIIVGSVGKHSDLDKQLQIFRDRFPRWKGDSVPRLIVDMLSPFALPTQSLDAR
KAAIEAIGLVCQSWPRNYVLAKVYTAFQQVFQDQVPSLESLVLRSFKEFLMTEEKRSEAGAEAASGDKKKELTVM
GGTNFDDVASATTQRFLKDMTRIALGSQDEHAFLAMEVLGSINRQGLTHPKETGVTLMTLETSANRKIAELAFME
HRSLHEKHETVLEREYIKAVQSAYNYQRDVVKDCRGATTEPLQSKLHLLMEVLKISKMKNRQRFLEKLCGQVDFD
LGKLDEARTGDVPDHVGFSRFVIESVAFMEFQTVGEVQTTVNTMEKIVSSTGATIAQAIESEVLDLRMDADEPTN
ESAVGDGVLVAAAPTTDDGQTTEAKAAIMQSKVEPRRLRQLAAASVILLSLWEARTHVRKLYGMGTHRHDSKAKA
LAKDLNKTPTKVQGVHGDRVWDELANHMGGLENEERMAGKCCEFVELMNVDKEFKVADEDDEMGGVDGPTTPSEG
GGDDEEEAPDRGRKRKGAATPGGRKKRPRSGSQPRKRGRPRKQSMAPSEEAADMDGDWI
Coding >Ophio5|2897
ATGCTTCCACGCGGTGCGAACGGTCCCACAAATGGGGTCGACATGCTTCAACCTCCGCCGCAACCTCATCCCGCC
ATCTCGCGGCCCTTCACGCTGCAAGAGTCGCTGCCCTATTCGCCCCAGACGTCGACGGCGCCCCTACTTCCTGAT
GTGATTCCCGACCCGACTTTGGGATCAGGCTCGCCCGCTCTGCCCATATCGGGCCTGTTCCCGCGAGACGAGTTC
GACAGGGTCAACGCCGAGGCCTTGAATCATCCGCAAGGCTCGAGGACCTTGAAGCAGGCTGCAGATTACGTTCTG
CACGATCTGAAGCCGTCCCAAAGAACCCAATACAAGTTTTCGGCCATACCGCCCGGGCCACCTGGCCCGCCACCC
AGCAAGAGCCTTTCGCATGGCCTCTCGCCCATGACCAGAAGCGTGTACGACAGGGTGGGAAGCTTCTTCAAGTCG
ACCAAAGCCAACATTGCAGGCCCCAAGGCGAATGGCGAGGTCCATCAACTGCCGAAATCAACCAAGGAATCTCCG
TCGCTAAGCTCCAGAGCCCCTTCATATGCGCAAGACAGGCGATCGGAGAACCCTCAGGCGTATAGATCCCCCTCC
TGTAGGATAGAGGTGGCCATTCCGTCGAAAAAAACCTTCGACCCGTCTTCATATATCGACGTCGCGACGTCGGGC
CCGCCGCTGGAGTCGATACCACATTCGATACCGCAGGAGCTCCCTGCCAAAGTCAAACTTCCCTCTTCCAACAAT
GGCAACGCAGTCATTAAAGAACAATCTCCTTCGGGCGGGAAGAACCTGGCCTTCAGCATTGAGCTTCCCAAGGCC
AACATCAAAAAGGAAGAGTATCTCGAGGTATGCGAGGTTCCAGACGCTCCGAGAAGCCTTTCGACCCGGCGGCCG
GAAACACAAGACGTAGCTCACAGCCAGGGCGTTACCGTCACCAGTCTCGATCAGCGTCAGAGGAGCGAGGTAGCT
CTAGATGCCCTTGATGCGCTTTTTCGATCCATCTTCGCCGCGGTGGGAAGCGCCCTCGCCATGGAGCCGGGATCC
GAGCACATCGTGACCTTGAAGGCAGATCACGAACCTGCCATGACGTCTGCGACGCAACAGAAGCTACACGGCGCC
ATCCAGAAAATCATTGATCTGAGATGCTTCGAGAGCGTCGCTTTGGAGAATCTGCTGCAGATCATCAAACTGAGC
GACTCGAGCCTGAGACAGGTCGAAAGCCTGGAATTTCGCGTCGACGAGAGTTGGGACGAAGGCGCCGTGGACTCG
TGGGTCCAGCAACTGTCCGAGGTTGAAACGGCGTTGAAAGCTGCACGCACTTGCTTGCGCTTGCTCTCCGGGGGC
CGCGAAGACAGACAGCTCTACTCCGAATCGACCATTCAGCGGTGCGTTGACCTCTTCAAGTCTGTCACTGAAGAC
TTGGTCATTCCGCTGGTCGAGCTGCGCAACTCGGGGCCGGCCGCGAGCCTCTTCAAGCTGGTGCAGAAGCACAAA
AAGGCCGTCTCGTCAACCTTTGTCTGCTGCCAGAAGCTGTTTGCCATACTTGCGGAGCTCGTAACCAAAATCGAA
TTCTCCGAGTCGGTCATCAACACGCTGGAGTACACCTCATCCAAACTCATCTTCGTGGAGAATGCATACTTTGAG
AAGGACTCTGCCATCGGCCCCCAGAGGTTCGACGGCATTCGCTCCGTTGCCATGGACATGCTCTGCCAAATCTTT
CTCATCAAGCCCGAGCAGAGGCAGGGCATCATCGACGACATACTCACCTCGCTCGAGAAGCTTCCCGTTGGAAAG
CAAAGCTCCAGACAATTCAAGCTGTCTGACGGCGGCAGCATTCAGCCCGTCTCGGCTCTCATCATGCGTCTGGTT
CAGGCAAGCTCTGGGAGGGTCAACGTTGACGACGGGAGCGGGCGGGCTGCCATCCTTCAACGCATCAACGGCACC
GACACTGGGCCAGGCGAAGGGTCGGCCGCGTCTAAGAAGAGCCAGGCGCCGTATACGGTGACGACGGAAGATGTT
GGTGCTCAGCAACACGCCGTAGCCGTGCAGGAGCTGAAAGCCAGCGCCGTGCCCCTTACCGATGCAGCGAGCCGC
AACGCGTCCTACGTCATCAACTTCATCGTCAAGCGAGCCATCGGCTCTACCAAAACTGGAGACACGCCGTACCGA
AACCTCTTGGATCTCTTCGTGGATGACTTTACAACCTGCCTCGACTCGCCGGACTGGCCATCGGCAGAGCTTCTT
CTTCGCCTCTTGATGTTCATGATGGTGCAGCTGTTCGAGGCCGGCAAGACGGCCGCGCCGGCCAAGAACATGGCG
CTGGAGCTGCTGGGCGCTATGAGCGCCGCGATTTCGCGCCTCCGCTCGCACGTGAAGAAGACGGCGGGACTGTTT
GAAGGCAGCGACGCCAGCGAGCTGTCGCAGTATCTGTCGGAACTGGCCATCCTCGTCCTCGAGCAGAAGAGCCAA
ATGGAGCACATCAGCACGTGGTCGGGACCCTACCGCGTGTCCCTGGAACACCTTCAGGAGCGCTGCTCCGACGAC
CCTCATCTGGCGGGCGCGGCATCGTACATGTCCACGGACTGGGCGAACAAGATCCACGTCGCCTACGACACTGTC
CAAGAAGGCGACAAGGAGCGGGATCAAGAACTGGGCCGCTTGGCTTACCGGCTTCGAATGATGATTGAGGATCGG
AAATGGCTGTCCAGCCAGTACACGTTCAAAGCCGTGTCGGCCAGCCAGGCCAGATTCGCCTATTCGATCATCCTG
CTACGGTCTCCCTTGTGTGAGGCTTTCGGCAAGATTGTCAACATCCTGCTGGGTTCCATGGCTAGCGACCAGGCG
ACGGTGCGGAGCAAGAGCTTGAAGAGCATCCATCAAGTGCTCGAGACGGATCCGTCGATTCTGGACGGCGATTCG
ACCGTCATCCAGTTGATACTCGACTGCGCCAGCGACTCGTCGACGCAGGTTCGAGACTCGGCTCTTGGTCTGCTC
GGCAACTGCATAGGAATGCGGCGCGCCCTCGAGTCGTCGCTGACGCCGAGAATCATCGAGCGATTCCAGGACGCC
GGCGTGGGAGTCAGAAAGAGGGCGATGAAGCTCGCGCGCGACATCTATCTCCGCAACCGAAGCAAGACGCTCCGA
AGCGCCATTGCCAATGGTCTGCTCCGCCGAGCTCAGGACCCAGACGAGGGCGTGCGCGATCTCTCGAGGCAGATG
ATCGAGGAGGTCTGGTTTGCGCCCTTCTACTCCAACGAAAACACGGCAGCGTTTGAAACGTCGCTCGCGGAGCAT
GTGGCGCTCATCATCCAGACGGTCAAGACGGGGACAGTGACCGAGGTCCTCGACAAGGTGTTTCAGACGGTGCTC
AGGCCGCAGAACAGGTCACTGGAGGGGCCATTCTCGGTGTGCTCGAGGCTGGTCGGGACCATGTTTGGAATGATC
GACAACCCCGACTCGGAGGACACGACGGTCCCGTCGGGACGCGACGCGTTGCAAGTTCTCACCATCTTTGCCAAG
GCCGACCCGAAGCTCTTTAACTTTGAGCAGATCCGGCTGCTGAAGCCTCAGTTGGCCAGTTTCTCTGGCCGCGAC
GAGTTGGCCGCTTTCCGAGCCGTGACGGTGATTTACAAAAGGGTCCTTCCGCAGCTGCCGATGGTACACGCAGAG
TTTCTCGCCGACGTACGCCTGCAGCTCCTCAAGGCCATCGGCAAGATTTTCTCGCGCGTCGCGCTCGACGACTTG
ATCGCCTGCACGCAAGTCGTCTGCGAGCTGCTGAGGGACTTTTCCCCTTTGGCGAACCTCGTCGCGTCGAGCCTC
TTGGGCATCCAGAAGCTGGGTAAGGACACACTGGACAAGAGGGGGCTCGGGCAACTCTGCGCCTATGCCATCATC
GTGGGGAGTGTCGGCAAGCATTCGGACCTGGATAAGCAGCTTCAGATCTTCCGCGACAGGTTTCCTCGCTGGAAG
GGAGACTCGGTTCCCCGGCTGATAGTCGACATGCTCTCGCCCTTCGCCTTGCCGACGCAATCTCTGGACGCGCGG
AAAGCGGCCATCGAGGCCATCGGGCTGGTGTGCCAGTCGTGGCCTCGCAACTACGTCCTGGCCAAGGTGTACACG
GCCTTTCAGCAGGTGTTCCAGGACCAAGTGCCGTCACTGGAGTCTCTAGTTCTTCGCTCGTTCAAGGAATTTCTC
ATGACGGAGGAGAAGAGGTCCGAGGCCGGCGCCGAGGCCGCATCGGGAGACAAGAAGAAGGAGTTGACGGTCATG
GGCGGAACCAACTTTGACGACGTGGCGAGCGCAACGACGCAGCGGTTCCTCAAGGACATGACGCGGATAGCGCTG
GGAAGTCAAGATGAGCATGCCTTTCTGGCCATGGAAGTCCTGGGCAGCATCAACCGACAGGGCCTGACACACCCC
AAGGAGACGGGGGTGACGCTGATGACGCTGGAGACGTCGGCCAACCGGAAAATCGCAGAGCTCGCGTTTATGGAA
CATCGGTCGCTGCACGAGAAACACGAGACGGTGCTGGAGAGAGAGTACATCAAGGCGGTGCAGTCGGCCTACAAC
TACCAGCGAGACGTGGTCAAGGACTGCCGCGGGGCGACGACGGAACCTCTGCAGTCGAAGCTGCACCTGCTGATG
GAGGTTTTGAAGATCAGCAAGATGAAGAATCGGCAGCGGTTCCTGGAGAAGCTGTGCGGGCAGGTGGACTTTGAT
CTGGGCAAGCTGGACGAGGCAAGGACGGGAGACGTGCCGGATCACGTCGGCTTCTCGAGGTTCGTGATTGAGAGC
GTGGCGTTTATGGAGTTTCAGACGGTGGGCGAGGTGCAGACGACGGTGAACACCATGGAGAAGATTGTGTCGAGC
ACGGGAGCGACGATTGCGCAGGCCATCGAGTCGGAAGTCTTGGATCTTCGCATGGACGCGGATGAGCCTACCAAC
GAGTCGGCCGTGGGCGATGGCGTCTTAGTCGCGGCGGCACCTACAACCGATGATGGTCAAACGACGGAAGCCAAG
GCGGCAATAATGCAGTCCAAGGTCGAGCCGCGGCGATTGCGGCAGCTGGCGGCGGCGTCGGTCATTCTGCTCTCG
CTTTGGGAGGCGCGGACACATGTGCGAAAGCTGTACGGCATGGGCACACACCGACACGACAGCAAGGCCAAGGCG
CTGGCCAAGGACCTCAACAAGACGCCTACCAAGGTGCAGGGCGTTCACGGAGACCGGGTCTGGGACGAGCTGGCG
AACCACATGGGCGGACTGGAGAACGAGGAGCGGATGGCGGGCAAGTGCTGCGAGTTTGTGGAGCTGATGAACGTC
GACAAGGAGTTCAAGGTGGCGGACGAGGACGACGAGATGGGCGGCGTCGACGGGCCCACGACTCCGAGCGAGGGC
GGAGGCGACGACGAAGAAGAGGCTCCGGATAGGGGCAGGAAGCGGAAGGGGGCGGCGACACCGGGAGGGCGGAAG
AAGCGGCCGAGGTCCGGCTCGCAGCCTAGGAAAAGGGGCCGGCCAAGGAAGCAGAGCATGGCGCCGAGCGAGGAG
GCGGCCGACATGGATGGTGACTGGATT
Transcript >Ophio5|2897
ATGCTTCCACGCGGTGCGAACGGTCCCACAAATGGGGTCGACATGCTTCAACCTCCGCCGCAACCTCATCCCGCC
ATCTCGCGGCCCTTCACGCTGCAAGAGTCGCTGCCCTATTCGCCCCAGACGTCGACGGCGCCCCTACTTCCTGAT
GTGATTCCCGACCCGACTTTGGGATCAGGCTCGCCCGCTCTGCCCATATCGGGCCTGTTCCCGCGAGACGAGTTC
GACAGGGTCAACGCCGAGGCCTTGAATCATCCGCAAGGCTCGAGGACCTTGAAGCAGGCTGCAGATTACGTTCTG
CACGATCTGAAGCCGTCCCAAAGAACCCAATACAAGTTTTCGGCCATACCGCCCGGGCCACCTGGCCCGCCACCC
AGCAAGAGCCTTTCGCATGGCCTCTCGCCCATGACCAGAAGCGTGTACGACAGGGTGGGAAGCTTCTTCAAGTCG
ACCAAAGCCAACATTGCAGGCCCCAAGGCGAATGGCGAGGTCCATCAACTGCCGAAATCAACCAAGGAATCTCCG
TCGCTAAGCTCCAGAGCCCCTTCATATGCGCAAGACAGGCGATCGGAGAACCCTCAGGCGTATAGATCCCCCTCC
TGTAGGATAGAGGTGGCCATTCCGTCGAAAAAAACCTTCGACCCGTCTTCATATATCGACGTCGCGACGTCGGGC
CCGCCGCTGGAGTCGATACCACATTCGATACCGCAGGAGCTCCCTGCCAAAGTCAAACTTCCCTCTTCCAACAAT
GGCAACGCAGTCATTAAAGAACAATCTCCTTCGGGCGGGAAGAACCTGGCCTTCAGCATTGAGCTTCCCAAGGCC
AACATCAAAAAGGAAGAGTATCTCGAGGTATGCGAGGTTCCAGACGCTCCGAGAAGCCTTTCGACCCGGCGGCCG
GAAACACAAGACGTAGCTCACAGCCAGGGCGTTACCGTCACCAGTCTCGATCAGCGTCAGAGGAGCGAGGTAGCT
CTAGATGCCCTTGATGCGCTTTTTCGATCCATCTTCGCCGCGGTGGGAAGCGCCCTCGCCATGGAGCCGGGATCC
GAGCACATCGTGACCTTGAAGGCAGATCACGAACCTGCCATGACGTCTGCGACGCAACAGAAGCTACACGGCGCC
ATCCAGAAAATCATTGATCTGAGATGCTTCGAGAGCGTCGCTTTGGAGAATCTGCTGCAGATCATCAAACTGAGC
GACTCGAGCCTGAGACAGGTCGAAAGCCTGGAATTTCGCGTCGACGAGAGTTGGGACGAAGGCGCCGTGGACTCG
TGGGTCCAGCAACTGTCCGAGGTTGAAACGGCGTTGAAAGCTGCACGCACTTGCTTGCGCTTGCTCTCCGGGGGC
CGCGAAGACAGACAGCTCTACTCCGAATCGACCATTCAGCGGTGCGTTGACCTCTTCAAGTCTGTCACTGAAGAC
TTGGTCATTCCGCTGGTCGAGCTGCGCAACTCGGGGCCGGCCGCGAGCCTCTTCAAGCTGGTGCAGAAGCACAAA
AAGGCCGTCTCGTCAACCTTTGTCTGCTGCCAGAAGCTGTTTGCCATACTTGCGGAGCTCGTAACCAAAATCGAA
TTCTCCGAGTCGGTCATCAACACGCTGGAGTACACCTCATCCAAACTCATCTTCGTGGAGAATGCATACTTTGAG
AAGGACTCTGCCATCGGCCCCCAGAGGTTCGACGGCATTCGCTCCGTTGCCATGGACATGCTCTGCCAAATCTTT
CTCATCAAGCCCGAGCAGAGGCAGGGCATCATCGACGACATACTCACCTCGCTCGAGAAGCTTCCCGTTGGAAAG
CAAAGCTCCAGACAATTCAAGCTGTCTGACGGCGGCAGCATTCAGCCCGTCTCGGCTCTCATCATGCGTCTGGTT
CAGGCAAGCTCTGGGAGGGTCAACGTTGACGACGGGAGCGGGCGGGCTGCCATCCTTCAACGCATCAACGGCACC
GACACTGGGCCAGGCGAAGGGTCGGCCGCGTCTAAGAAGAGCCAGGCGCCGTATACGGTGACGACGGAAGATGTT
GGTGCTCAGCAACACGCCGTAGCCGTGCAGGAGCTGAAAGCCAGCGCCGTGCCCCTTACCGATGCAGCGAGCCGC
AACGCGTCCTACGTCATCAACTTCATCGTCAAGCGAGCCATCGGCTCTACCAAAACTGGAGACACGCCGTACCGA
AACCTCTTGGATCTCTTCGTGGATGACTTTACAACCTGCCTCGACTCGCCGGACTGGCCATCGGCAGAGCTTCTT
CTTCGCCTCTTGATGTTCATGATGGTGCAGCTGTTCGAGGCCGGCAAGACGGCCGCGCCGGCCAAGAACATGGCG
CTGGAGCTGCTGGGCGCTATGAGCGCCGCGATTTCGCGCCTCCGCTCGCACGTGAAGAAGACGGCGGGACTGTTT
GAAGGCAGCGACGCCAGCGAGCTGTCGCAGTATCTGTCGGAACTGGCCATCCTCGTCCTCGAGCAGAAGAGCCAA
ATGGAGCACATCAGCACGTGGTCGGGACCCTACCGCGTGTCCCTGGAACACCTTCAGGAGCGCTGCTCCGACGAC
CCTCATCTGGCGGGCGCGGCATCGTACATGTCCACGGACTGGGCGAACAAGATCCACGTCGCCTACGACACTGTC
CAAGAAGGCGACAAGGAGCGGGATCAAGAACTGGGCCGCTTGGCTTACCGGCTTCGAATGATGATTGAGGATCGG
AAATGGCTGTCCAGCCAGTACACGTTCAAAGCCGTGTCGGCCAGCCAGGCCAGATTCGCCTATTCGATCATCCTG
CTACGGTCTCCCTTGTGTGAGGCTTTCGGCAAGATTGTCAACATCCTGCTGGGTTCCATGGCTAGCGACCAGGCG
ACGGTGCGGAGCAAGAGCTTGAAGAGCATCCATCAAGTGCTCGAGACGGATCCGTCGATTCTGGACGGCGATTCG
ACCGTCATCCAGTTGATACTCGACTGCGCCAGCGACTCGTCGACGCAGGTTCGAGACTCGGCTCTTGGTCTGCTC
GGCAACTGCATAGGAATGCGGCGCGCCCTCGAGTCGTCGCTGACGCCGAGAATCATCGAGCGATTCCAGGACGCC
GGCGTGGGAGTCAGAAAGAGGGCGATGAAGCTCGCGCGCGACATCTATCTCCGCAACCGAAGCAAGACGCTCCGA
AGCGCCATTGCCAATGGTCTGCTCCGCCGAGCTCAGGACCCAGACGAGGGCGTGCGCGATCTCTCGAGGCAGATG
ATCGAGGAGGTCTGGTTTGCGCCCTTCTACTCCAACGAAAACACGGCAGCGTTTGAAACGTCGCTCGCGGAGCAT
GTGGCGCTCATCATCCAGACGGTCAAGACGGGGACAGTGACCGAGGTCCTCGACAAGGTGTTTCAGACGGTGCTC
AGGCCGCAGAACAGGTCACTGGAGGGGCCATTCTCGGTGTGCTCGAGGCTGGTCGGGACCATGTTTGGAATGATC
GACAACCCCGACTCGGAGGACACGACGGTCCCGTCGGGACGCGACGCGTTGCAAGTTCTCACCATCTTTGCCAAG
GCCGACCCGAAGCTCTTTAACTTTGAGCAGATCCGGCTGCTGAAGCCTCAGTTGGCCAGTTTCTCTGGCCGCGAC
GAGTTGGCCGCTTTCCGAGCCGTGACGGTGATTTACAAAAGGGTCCTTCCGCAGCTGCCGATGGTACACGCAGAG
TTTCTCGCCGACGTACGCCTGCAGCTCCTCAAGGCCATCGGCAAGATTTTCTCGCGCGTCGCGCTCGACGACTTG
ATCGCCTGCACGCAAGTCGTCTGCGAGCTGCTGAGGGACTTTTCCCCTTTGGCGAACCTCGTCGCGTCGAGCCTC
TTGGGCATCCAGAAGCTGGGTAAGGACACACTGGACAAGAGGGGGCTCGGGCAACTCTGCGCCTATGCCATCATC
GTGGGGAGTGTCGGCAAGCATTCGGACCTGGATAAGCAGCTTCAGATCTTCCGCGACAGGTTTCCTCGCTGGAAG
GGAGACTCGGTTCCCCGGCTGATAGTCGACATGCTCTCGCCCTTCGCCTTGCCGACGCAATCTCTGGACGCGCGG
AAAGCGGCCATCGAGGCCATCGGGCTGGTGTGCCAGTCGTGGCCTCGCAACTACGTCCTGGCCAAGGTGTACACG
GCCTTTCAGCAGGTGTTCCAGGACCAAGTGCCGTCACTGGAGTCTCTAGTTCTTCGCTCGTTCAAGGAATTTCTC
ATGACGGAGGAGAAGAGGTCCGAGGCCGGCGCCGAGGCCGCATCGGGAGACAAGAAGAAGGAGTTGACGGTCATG
GGCGGAACCAACTTTGACGACGTGGCGAGCGCAACGACGCAGCGGTTCCTCAAGGACATGACGCGGATAGCGCTG
GGAAGTCAAGATGAGCATGCCTTTCTGGCCATGGAAGTCCTGGGCAGCATCAACCGACAGGGCCTGACACACCCC
AAGGAGACGGGGGTGACGCTGATGACGCTGGAGACGTCGGCCAACCGGAAAATCGCAGAGCTCGCGTTTATGGAA
CATCGGTCGCTGCACGAGAAACACGAGACGGTGCTGGAGAGAGAGTACATCAAGGCGGTGCAGTCGGCCTACAAC
TACCAGCGAGACGTGGTCAAGGACTGCCGCGGGGCGACGACGGAACCTCTGCAGTCGAAGCTGCACCTGCTGATG
GAGGTTTTGAAGATCAGCAAGATGAAGAATCGGCAGCGGTTCCTGGAGAAGCTGTGCGGGCAGGTGGACTTTGAT
CTGGGCAAGCTGGACGAGGCAAGGACGGGAGACGTGCCGGATCACGTCGGCTTCTCGAGGTTCGTGATTGAGAGC
GTGGCGTTTATGGAGTTTCAGACGGTGGGCGAGGTGCAGACGACGGTGAACACCATGGAGAAGATTGTGTCGAGC
ACGGGAGCGACGATTGCGCAGGCCATCGAGTCGGAAGTCTTGGATCTTCGCATGGACGCGGATGAGCCTACCAAC
GAGTCGGCCGTGGGCGATGGCGTCTTAGTCGCGGCGGCACCTACAACCGATGATGGTCAAACGACGGAAGCCAAG
GCGGCAATAATGCAGTCCAAGGTCGAGCCGCGGCGATTGCGGCAGCTGGCGGCGGCGTCGGTCATTCTGCTCTCG
CTTTGGGAGGCGCGGACACATGTGCGAAAGCTGTACGGCATGGGCACACACCGACACGACAGCAAGGCCAAGGCG
CTGGCCAAGGACCTCAACAAGACGCCTACCAAGGTGCAGGGCGTTCACGGAGACCGGGTCTGGGACGAGCTGGCG
AACCACATGGGCGGACTGGAGAACGAGGAGCGGATGGCGGGCAAGTGCTGCGAGTTTGTGGAGCTGATGAACGTC
GACAAGGAGTTCAAGGTGGCGGACGAGGACGACGAGATGGGCGGCGTCGACGGGCCCACGACTCCGAGCGAGGGC
GGAGGCGACGACGAAGAAGAGGCTCCGGATAGGGGCAGGAAGCGGAAGGGGGCGGCGACACCGGGAGGGCGGAAG
AAGCGGCCGAGGTCCGGCTCGCAGCCTAGGAAAAGGGGCCGGCCAAGGAAGCAGAGCATGGCGCCGAGCGAGGAG
GCGGCCGACATGGATGGTGACTGGATTTAG
Gene >Ophio5|2897
ATGCTTCCACGCGGTGCGAACGGTCCCACAAATGGGGTCGACATGCTTCAACCTCCGCCGCAACCTCATCCCGCC
ATCTCGCGGCCCTTCACGCTGCAAGAGTCGCTGCCCTATTCGCCCCAGACGTCGACGGCGCCCCTACTTCCTGGT
CAGTGTCTTTTGAAACCGCGCGGAGCTTGTACTGACGCGGCCCCTTAGATGTGATTCCCGACCCGACTTTGGGAT
CAGGCTCGCCCGCTCTGCCCATATCGGGCCTGTTCCCGCGAGACGAGTTCGACAGGGTCAACGCCGAGGCCTTGA
ATCATCCGCAAGGCTCGAGGACCTTGAAGCAGGCTGCAGATTACGTTCTGCACGATCTGAAGCCGTCCCAAAGAA
CCCAATAGTTCGTCATGACTTTTACCACACACACTCTCTCTTCTTCTTATAGGCTGACCGTTCTTCAGCAAGTTT
TCGGCCATACCGCCCGGGCCACCTGGCCCGCCACCCAGCAAGAGCCTTTCGCATGGCCTCTCGCCCATGACCAGA
AGCGTGTACGACAGGGTGGGAAGCTTCTTCAAGTCGACCAAAGCCAACATTGCAGGCCCCAAGGCGAATGGCGAG
GTCCATCAACTGCCGAAATCAACCAAGGAATCTCCGTCGCTAAGCTCCAGAGCCCCTTCATATGCGCAAGACAGG
CGATCGGAGAACCCTCAGGCGTATAGATCCCCCTCCTGTAGGATAGAGGTGGCCATTCCGTCGAAAAAAACCTTC
GACCCGTCTTCATATATCGACGTCGCGACGTCGGGCCCGCCGCTGGAGTCGATACCACATTCGATACCGCAGGAG
CTCCCTGCCAAAGTCAAACTTCCCTCTTCCAACAATGGCAACGCAGTCATTAAAGAACAATCTCCTTCGGGCGGG
AAGAACCTGGCCTTCAGCATTGAGCTTCCCAAGGCCAACATCAAAAAGGAAGAGTATCTCGAGGTATGCGAGGTT
CCAGACGCTCCGAGAAGCCTTTCGACCCGGCGGCCGGAAACACAAGACGTAGCTCACAGCCAGGGCGTTACCGTC
ACCAGTCTCGATCAGCGTCAGAGGAGCGAGGTAGCTCTAGATGCCCTTGATGCGCTTTTTCGATCCATCTTCGCC
GCGGTGGGAAGCGCCCTCGCCATGGAGCCGGGATCCGAGCACATCGTGACCTTGAAGGCAGATCACGAACCTGCC
ATGACGTCTGCGACGCAACAGAAGCTACACGGCGCCATCCAGAAAATCATTGATCTGAGATGCTTCGAGAGCGTC
GCTTTGGAGAATCTGCTGCAGATCATCAAACTGAGCGACTCGAGCCTGAGACAGGTCGAAAGCCTGGAATTTCGC
GTCGACGAGAGTTGGGACGAAGGCGCCGTGGACTCGTGGGTCCAGCAACTGTCCGAGGTTGAAACGGCGTTGAAA
GCTGCACGCACTTGCTTGCGCTTGCTCTCCGGGGGCCGCGAAGACAGACAGCTCTACTCCGAATCGACCATTCAG
CGGTGCGTTGACCTCTTCAAGTCTGTCACTGAAGACTTGGTCATTCCGCTGGTCGAGCTGCGCAACTCGGGGCCG
GCCGCGAGCCTCTTCAAGCTGGTGCAGAAGCACAAAAAGGCCGTCTCGTCAACCTTTGTCTGCTGCCAGAAGCTG
TTTGCCATACTTGCGGAGCTCGTAACCAAAATCGAATTCTCCGAGTCGGTCATCAACACGCTGGAGTACACCTCA
TCCAAACTCATCTTCGTGGAGAATGCATACTTTGAGAAGGACTCTGCCATCGGCCCCCAGAGGTTCGACGGCATT
CGCTCCGTTGCCATGGACATGCTCTGCCAAATCTTTCTCATCAAGCCCGAGCAGAGGCAGGGCATCATCGACGAC
ATACTCACCTCGCTCGAGAAGCTTCCCGTTGGAAAGCAAAGCTCCAGACAATTCAAGCTGTCTGACGGCGGCAGC
ATTCAGCCCGTCTCGGCTCTCATCATGCGTCTGGTTCAGGCAAGCTCTGGGAGGGTCAACGTTGACGACGGGAGC
GGGCGGGCTGCCATCCTTCAACGCATCAACGGCACCGACACTGGGCCAGGCGAAGGGTCGGCCGCGTCTAAGAAG
AGCCAGGCGCCGTATACGGTGACGACGGAAGATGTTGGTGCTCAGCAACACGCCGTAGCCGTGCAGGAGCTGAAA
GCCAGCGCCGTGCCCCTTACCGATGCAGCGAGCCGCAACGCGTCCTACGTCATCAACTTCATCGTCAAGCGAGCC
ATCGGCTCTACCAAAACTGGAGACACGCCGTACCGAAACCTCTTGGATCTCTTCGTGGATGACTTTACAACCTGC
CTCGACTCGCCGGACTGGCCATCGGCAGAGCTTCTTCTTCGCCTCTTGATGTTCATGATGGTGCAGCTGTTCGAG
GCCGGCAAGACGGCCGCGCCGGCCAAGAACATGGCGCTGGAGCTGCTGGGCGCTATGAGCGCCGCGATTTCGCGC
CTCCGCTCGCACGTGAAGAAGACGGCGGGACTGTTTGAAGGCAGCGACGCCAGCGAGCTGTCGCAGTATCTGTCG
GAACTGGCCATCCTCGTCCTCGAGCAGAAGAGCCAAATGGAGCACATCAGCACGTGGTCGGGACCCTACCGCGTG
TCCCTGGAACACCTTCAGGAGCGCTGCTCCGACGACCCTCATCTGGCGGGCGCGGCATCGTACATGTCCACGGAC
TGGGCGAACAAGATCCACGTCGCCTACGACACTGTCCAAGAAGGCGACAAGGAGCGGGATCAAGAACTGGGCCGC
TTGGCTTACCGGCTTCGAATGATGATTGAGGATCGGAAATGGCTGTCCAGCCAGTACACGTTCAAAGCCGTGTCG
GCCAGCCAGGCCAGATTCGCCTATTCGATCATCCTGCTACGGTCTCCCTTGTGTGAGGCTTTCGGCAAGATTGTC
AACATCCTGCTGGGTTCCATGGCTAGCGACCAGGCGACGGTGCGGAGCAAGAGCTTGAAGAGCATCCATCAAGTG
CTCGAGACGGATCCGTCGATTCTGGACGGCGATTCGACCGTCATCCAGTTGATACTCGACTGCGCCAGCGACTCG
TCGACGCAGGTTCGAGACTCGGCTCTTGGTCTGCTCGGCAACTGCATAGGAATGCGGCGCGCCCTCGAGTCGTCG
CTGACGCCGAGAATCATCGAGCGATTCCAGGACGCCGGCGTGGGAGTCAGAAAGAGGGCGATGAAGCTCGCGCGC
GACATCTATCTCCGCAACCGAAGCAAGACGCTCCGAAGCGCCATTGCCAATGGTCTGCTCCGCCGAGCTCAGGAC
CCAGACGAGGGCGTGCGCGATCTCTCGAGGCAGATGATCGAGGAGGTCTGGTTTGCGCCCTTCTACTCCAACGAA
AACACGGCAGCGTTTGAAACGTCGCTCGCGGAGCATGTGGCGCTCATCATCCAGACGGTCAAGACGGGGACAGTG
ACCGAGGTCCTCGACAAGGTGTTTCAGACGGTGCTCAGGCCGCAGAACAGGTCACTGGAGGGGCCATTCTCGGTG
TGCTCGAGGCTGGTCGGGACCATGTTTGGAATGATCGACAACCCCGACTCGGAGGACACGACGGTCCCGTCGGGA
CGCGACGCGTTGCAAGTTCTCACCATCTTTGCCAAGGCCGACCCGAAGCTCTTTAACTTTGAGCAGATCCGGCTG
CTGAAGCCTCAGTTGGCCAGTTTCTCTGGCCGCGACGAGTTGGCCGCTTTCCGAGCCGTGACGGTGATTTACAAA
AGGGTCCTTCCGCAGCTGCCGATGGTACACGCAGAGTTTCTCGCCGACGTACGCCTGCAGCTCCTCAAGGCCATC
GGCAAGATTTTCTCGCGCGTCGCGCTCGACGACTTGATCGCCTGCACGCAAGTCGTCTGCGAGCTGCTGAGGGAC
TTTTCCCCTTTGGCGAACCTCGTCGCGTCGAGCCTCTTGGGCATCCAGAAGCTGGGTAAGGACACACTGGACAAG
AGGGGGCTCGGGCAACTCTGCGCCTATGCCATCATCGTGGGGAGTGTCGGCAAGCATTCGGACCTGGATAAGCAG
CTTCAGATCTTCCGCGACAGGTTTCCTCGCTGGAAGGGAGACTCGGTTCCCCGGCTGATAGTCGACATGCTCTCG
CCCTTCGCCTTGCCGACGCAATCTCTGGACGCGCGGAAAGCGGCCATCGAGGCCATCGGGCTGGTGTGCCAGTCG
TGGCCTCGCAACTACGTCCTGGCCAAGGTGTACACGGCCTTTCAGCAGGTGTTCCAGGACCAAGTGCCGTCACTG
GAGTCTCTAGTTCTTCGCTCGTTCAAGGAATTTCTCATGACGGAGGAGAAGAGGTCCGAGGCCGGCGCCGAGGCC
GCATCGGGAGACAAGAAGAAGGAGTTGACGGTCATGGGCGGAACCAACTTTGACGACGTGGCGAGCGCAACGACG
CAGCGGTTCCTCAAGGACATGACGCGGATAGCGCTGGGAAGTCAAGATGAGCATGCCTTTCTGGCCATGGAAGTC
CTGGGCAGCATCAACCGACAGGGCCTGACACACCCCAAGGAGACGGGGGTGACGCTGATGACGCTGGAGACGTCG
GCCAACCGGAAAATCGCAGAGCTCGCGTTTATGGAACATCGGTCGCTGCACGAGAAACACGAGACGGTGCTGGAG
AGAGAGTACATCAAGGCGGTGCAGTCGGCCTACAACTACCAGCGAGACGTGGTCAAGGACTGCCGCGGGGCGACG
ACGGAACCTCTGCAGTCGAAGCTGCACCTGCTGATGGAGGTTTTGAAGATCAGCAAGATGAAGAATCGGCAGCGG
TTCCTGGAGAAGCTGTGCGGGCAGGTGGACTTTGATCTGGGCAAGCTGGACGAGGCAAGGACGGGAGACGTGCCG
GATCACGTCGGCTTCTCGAGGTTCGTGATTGAGAGCGTGGCGTTTATGGAGTTTCAGACGGTGGGCGAGGTGCAG
ACGACGGTGAACACCATGGAGAAGATTGTGTCGAGCACGGGAGCGACGATTGCGCAGGCCATCGAGTCGGAAGTC
TTGGATCTTCGCATGGACGCGGATGAGCCTACCAACGAGTCGGCCGTGGGCGATGGCGTCTTAGTCGCGGCGGCA
CCTACAACCGATGATGGTCAAACGACGGAAGCCAAGGCGGCAATAATGCAGTCCAAGGTCGAGCCGCGGCGATTG
CGGCAGCTGGCGGCGGCGTCGGTCATTCTGCTCTCGCTTTGGGAGGCGCGGACACATGTGCGAAAGCTGTACGGC
ATGGGCACACACCGACACGACAGCAAGGCCAAGGCGCTGGCCAAGGACCTCAACAAGACGCCTACCAAGGTGCAG
GGCGTTCACGGAGACCGGGTCTGGGACGAGCTGGCGAACCACATGGGCGGACTGGAGAACGAGGAGCGGATGGCG
GGCAAGTGCTGCGAGTTTGTGGAGCTGATGAACGTCGACAAGGAGTTCAAGGTGGCGGACGAGGACGACGAGATG
GGCGGCGTCGACGGGCCCACGACTCCGAGCGAGGGCGGAGGCGACGACGAAGAAGAGGCTCCGGATAGGGGCAGG
AAGCGGAAGGGGGCGGCGACACCGGGAGGGCGGAAGAAGCGGCCGAGGTCCGGCTCGCAGCCTAGGAAAAGGGGC
CGGCCAAGGAAGCAGAGCATGGCGCCGAGCGAGGAGGCGGCCGACATGGATGGTGACTGGATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail