Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2892
Gene name
Locationscaffold_230:10452..11601
Strand+
Gene length (bp)1149
Transcript length (bp)969
Coding sequence length (bp)966
Protein length (aa) 322

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 2.2E-11 58 233

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B5P1|RGLC_EMENI Probable rhamnogalacturonate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rglC PE=3 SV=1 40 322 7.0E-52
sp|O15442|MPPD1_HUMAN Metallophosphoesterase domain-containing protein 1 OS=Homo sapiens GN=MPPED1 PE=2 SV=3 57 237 7.0E-28
sp|B1WBP0|MPPD2_RAT Metallophosphoesterase MPPED2 OS=Rattus norvegicus GN=Mpped2 PE=1 SV=1 57 237 9.0E-28
sp|Q91ZG2|MPPD1_MOUSE Metallophosphoesterase domain-containing protein 1 OS=Mus musculus GN=Mpped1 PE=2 SV=1 57 237 1.0E-27
sp|Q21268|YMSO_CAEEL UPF0046 protein K07C11.7 OS=Caenorhabditis elegans GN=K07C11.7 PE=1 SV=2 45 236 1.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B5P1|RGLC_EMENI Probable rhamnogalacturonate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rglC PE=3 SV=1 40 322 7.0E-52
sp|O15442|MPPD1_HUMAN Metallophosphoesterase domain-containing protein 1 OS=Homo sapiens GN=MPPED1 PE=2 SV=3 57 237 7.0E-28
sp|B1WBP0|MPPD2_RAT Metallophosphoesterase MPPED2 OS=Rattus norvegicus GN=Mpped2 PE=1 SV=1 57 237 9.0E-28
sp|Q91ZG2|MPPD1_MOUSE Metallophosphoesterase domain-containing protein 1 OS=Mus musculus GN=Mpped1 PE=2 SV=1 57 237 1.0E-27
sp|Q21268|YMSO_CAEEL UPF0046 protein K07C11.7 OS=Caenorhabditis elegans GN=K07C11.7 PE=1 SV=2 45 236 1.0E-27
sp|Q5REB1|MPPD2_PONAB Metallophosphoesterase MPPED2 OS=Pongo abelii GN=MPPED2 PE=2 SV=1 57 236 2.0E-26
sp|Q15777|MPPD2_HUMAN Metallophosphoesterase MPPED2 OS=Homo sapiens GN=MPPED2 PE=1 SV=1 57 236 2.0E-26
sp|Q9CZJ0|MPPD2_MOUSE Metallophosphoesterase MPPED2 OS=Mus musculus GN=Mpped2 PE=2 SV=1 57 236 3.0E-26
sp|Q18161|YBPT_CAEEL UPF0046 protein C25E10.12 OS=Caenorhabditis elegans GN=C25E10.12 PE=3 SV=1 22 237 5.0E-24
sp|Q22306|YW12_CAEEL UPF0046 protein T07D4.2 OS=Caenorhabditis elegans GN=T07D4.2 PE=1 SV=3 43 237 1.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2892
MGFLAGLGLRRRTPYDRLAPLDYLLVSPLALFATLLYRLFLYLRGSSLNPPRGKLPVRIVCISDTHDRTIHVPPG
DVLVHAGDLSTNGTASDIQAQLDWLKTLPHRVKIVVAGNHDRFFDPEARVPDDVNSNTRLDLDGLTYLEDEMSVQ
EIKGRRLSFFGSPHIPRCGSSSFAFQYPPMTPPWFSRVPPQTDILVTHGPPKHHRDLGLGCPGLLREIWRVRPRL
HVFGHVHSAYGTEPVYFDDMQAAYERLLSRPAGPIADLMPSRKWFDFLQIISLGVRSVLWKWLMAGPGSNQGGLL
VNAAQTYETTNIVKSRAIIVDL
Coding >Ophio5|2892
ATGGGCTTCCTCGCCGGCCTCGGCCTCCGCCGCCGCACCCCATACGACCGCCTCGCCCCCCTTGACTACCTCCTT
GTCTCGCCCCTCGCCCTGTTCGCGACGCTGCTCTACCGACTATTCCTTTACCTGCGCGGCTCTTCTCTGAACCCG
CCTCGGGGCAAGCTTCCCGTTCGCATCGTCTGCATCTCCGACACGCATGATCGCACCATTCATGTGCCTCCCGGA
GACGTCCTCGTCCACGCCGGTGATCTATCAACCAATGGCACCGCCTCCGATATCCAGGCCCAGCTCGACTGGCTC
AAGACGCTGCCTCATCGTGTCAAGATCGTTGTCGCCGGGAATCATGATCGCTTCTTTGACCCGGAAGCCCGTGTG
CCCGATGACGTCAACTCGAATACCCGACTTGACCTCGACGGCTTGACCTATCTCGAGGATGAGATGTCTGTACAG
GAGATCAAGGGTCGGCGTCTGTCTTTCTTCGGCTCGCCTCACATCCCTCGCTGCGGCTCGAGCAGCTTCGCCTTT
CAATACCCGCCCATGACTCCTCCGTGGTTCAGTAGAGTCCCCCCTCAGACGGACATTCTCGTGACCCATGGCCCT
CCTAAACACCATCGTGACCTCGGTCTCGGCTGCCCTGGCCTCCTCCGCGAAATATGGCGTGTCCGCCCTCGCCTC
CACGTCTTCGGTCACGTTCATAGCGCCTACGGCACCGAGCCCGTCTACTTCGACGACATGCAAGCCGCATACGAG
CGCCTCCTTTCCCGCCCTGCCGGTCCTATAGCTGACCTGATGCCCAGCCGCAAGTGGTTCGACTTCCTCCAAATC
ATCTCACTAGGTGTCCGGAGTGTCCTGTGGAAGTGGCTCATGGCCGGACCCGGCAGTAACCAAGGCGGCTTGTTG
GTCAACGCCGCCCAGACGTACGAGACGACCAACATCGTCAAGAGCCGTGCCATCATTGTCGATCTT
Transcript >Ophio5|2892
ATGGGCTTCCTCGCCGGCCTCGGCCTCCGCCGCCGCACCCCATACGACCGCCTCGCCCCCCTTGACTACCTCCTT
GTCTCGCCCCTCGCCCTGTTCGCGACGCTGCTCTACCGACTATTCCTTTACCTGCGCGGCTCTTCTCTGAACCCG
CCTCGGGGCAAGCTTCCCGTTCGCATCGTCTGCATCTCCGACACGCATGATCGCACCATTCATGTGCCTCCCGGA
GACGTCCTCGTCCACGCCGGTGATCTATCAACCAATGGCACCGCCTCCGATATCCAGGCCCAGCTCGACTGGCTC
AAGACGCTGCCTCATCGTGTCAAGATCGTTGTCGCCGGGAATCATGATCGCTTCTTTGACCCGGAAGCCCGTGTG
CCCGATGACGTCAACTCGAATACCCGACTTGACCTCGACGGCTTGACCTATCTCGAGGATGAGATGTCTGTACAG
GAGATCAAGGGTCGGCGTCTGTCTTTCTTCGGCTCGCCTCACATCCCTCGCTGCGGCTCGAGCAGCTTCGCCTTT
CAATACCCGCCCATGACTCCTCCGTGGTTCAGTAGAGTCCCCCCTCAGACGGACATTCTCGTGACCCATGGCCCT
CCTAAACACCATCGTGACCTCGGTCTCGGCTGCCCTGGCCTCCTCCGCGAAATATGGCGTGTCCGCCCTCGCCTC
CACGTCTTCGGTCACGTTCATAGCGCCTACGGCACCGAGCCCGTCTACTTCGACGACATGCAAGCCGCATACGAG
CGCCTCCTTTCCCGCCCTGCCGGTCCTATAGCTGACCTGATGCCCAGCCGCAAGTGGTTCGACTTCCTCCAAATC
ATCTCACTAGGTGTCCGGAGTGTCCTGTGGAAGTGGCTCATGGCCGGACCCGGCAGTAACCAAGGCGGCTTGTTG
GTCAACGCCGCCCAGACGTACGAGACGACCAACATCGTCAAGAGCCGTGCCATCATTGTCGATCTTTAA
Gene >Ophio5|2892
ATGGGCTTCCTCGCCGGCCTCGGCCTCCGCCGCCGCACCCCATACGACCGCCTCGCCCCCCTTGACTACCTCCTT
GTCTCGCCCCTCGCCCTGTTCGCGACGCTGCTCTACCGACTATTCCTTTACCTGCGCGGCTCTTCTCTGAACCCG
CCTCGGGGCAAGCTTCCCGTTCGCATCGTCTGCATCTCCGACACGCATGATCGCACCATTCATGTGCCTCCCGGA
GACGTCCTCGTCCACGCCGGTGATCTATCAACCAATGGCACCGCCTCCGATATCCAGGCCCAGCTCGACTGGCTC
AAGACGCTGCCTCATCGTGTCAAGATCGTTGTCGCCGGGAATCATGATCGCTTCTTTGACCCGGAAGCCCGTGTG
CCCGATGACGTCAACTCGAATACCCGACTTGACCTCGACGGCTTGACCTATCTCGAGGATGAGATGTCTGTACAG
GAGATCAAGGGTCGGCGTCTGTCTTTCTTCGGCTCGCCTCACATCCCTCGCTGCGGCTCGAGCAGCTTCGCGTGA
GTCCAAAGTCGTCATCCCCCATTTACATCATCCCGGCTCTTCCGGTCAGCGAGAACGCAGAACTGACTTCTTCTA
CGCCTGTCCACTGCTCGCTCCATCGACAGCTTTCAATACCCGCCCATGACTCCTCCGTGGTTCAGTAGAGTCCCC
CCTCAGACGGACATTCTCGTGACCCATGGCCCTCCTGTACGTCCCAGGCCTCTCCTCCTCCTCCTCCTCCTCCAG
AGGCACTCCAGCTGAGCTCCCGCATCCTCCCAGAAACACCATCGTGACCTCGGTCTCGGCTGCCCTGGCCTCCTC
CGCGAAATATGGCGTGTCCGCCCTCGCCTCCACGTCTTCGGTCACGTTCATAGCGCCTACGGCACCGAGCCCGTC
TACTTCGACGACATGCAAGCCGCATACGAGCGCCTCCTTTCCCGCCCTGCCGGTCCTATAGCTGACCTGATGCCC
AGCCGCAAGTGGTTCGACTTCCTCCAAATCATCTCACTAGGTGTCCGGAGTGTCCTGTGGAAGTGGCTCATGGCC
GGACCCGGCAGTAACCAAGGCGGCTTGTTGGTCAACGCCGCCCAGACGTACGAGACGACCAACATCGTCAAGAGC
CGTGCCATCATTGTCGATCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail