Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2891
Gene name
Locationscaffold_230:7432..10024
Strand-
Gene length (bp)2592
Transcript length (bp)2196
Coding sequence length (bp)2193
Protein length (aa) 731

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04547 Anoctamin Calcium-activated chloride channel 2.1E-115 168 629

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13621|YNG5_SCHPO Uncharacterized protein C691.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi030 PE=4 SV=1 37 624 1.0E-74
sp|Q9NW15|ANO10_HUMAN Anoctamin-10 OS=Homo sapiens GN=ANO10 PE=1 SV=2 131 683 4.0E-39
sp|Q4V8U5|ANO10_DANRE Anoctamin-10 OS=Danio rerio GN=ano10 PE=2 SV=1 139 624 1.0E-38
sp|Q8BH79|ANO10_MOUSE Anoctamin-10 OS=Mus musculus GN=Ano10 PE=1 SV=1 131 652 3.0E-36
sp|P38250|IST2_YEAST Increased sodium tolerance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IST2 PE=1 SV=2 55 587 7.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13621|YNG5_SCHPO Uncharacterized protein C691.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi030 PE=4 SV=1 37 624 1.0E-74
sp|Q9NW15|ANO10_HUMAN Anoctamin-10 OS=Homo sapiens GN=ANO10 PE=1 SV=2 131 683 4.0E-39
sp|Q4V8U5|ANO10_DANRE Anoctamin-10 OS=Danio rerio GN=ano10 PE=2 SV=1 139 624 1.0E-38
sp|Q8BH79|ANO10_MOUSE Anoctamin-10 OS=Mus musculus GN=Ano10 PE=1 SV=1 131 652 3.0E-36
sp|P38250|IST2_YEAST Increased sodium tolerance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IST2 PE=1 SV=2 55 587 7.0E-30
sp|Q0JJZ6|CACLC_ORYSJ Anoctamin-like protein Os01g0706700 OS=Oryza sativa subsp. japonica GN=Os01g0706700 PE=2 SV=1 135 640 1.0E-25
sp|Q6IFT6|ANO7_RAT Anoctamin-7 OS=Rattus norvegicus GN=Ano7 PE=2 SV=1 142 578 1.0E-24
sp|Q6PB70|ANO8_MOUSE Anoctamin-8 OS=Mus musculus GN=Ano8 PE=1 SV=3 107 382 2.0E-23
sp|Q14AT5|ANO7_MOUSE Anoctamin-7 OS=Mus musculus GN=Ano7 PE=2 SV=2 141 578 2.0E-23
sp|Q9HCE9|ANO8_HUMAN Anoctamin-8 OS=Homo sapiens GN=ANO8 PE=1 SV=3 107 408 2.0E-23
sp|Q6IWH7|ANO7_HUMAN Anoctamin-7 OS=Homo sapiens GN=ANO7 PE=1 SV=2 151 609 7.0E-22
sp|A0MFS9|CACLC_ARATH Anoctamin-like protein At1g73020 OS=Arabidopsis thaliana GN=At1g73020 PE=1 SV=1 93 620 2.0E-21
sp|A1A5B4|ANO9_HUMAN Anoctamin-9 OS=Homo sapiens GN=ANO9 PE=2 SV=3 91 600 3.0E-21
sp|Q6P9J9|ANO6_MOUSE Anoctamin-6 OS=Mus musculus GN=Ano6 PE=1 SV=1 108 578 4.0E-18
sp|Q6PB70|ANO8_MOUSE Anoctamin-8 OS=Mus musculus GN=Ano8 PE=1 SV=3 485 645 1.0E-17
sp|Q4KMQ2|ANO6_HUMAN Anoctamin-6 OS=Homo sapiens GN=ANO6 PE=1 SV=2 112 578 1.0E-17
sp|Q75V66|ANO5_HUMAN Anoctamin-5 OS=Homo sapiens GN=ANO5 PE=1 SV=1 108 578 1.0E-17
sp|Q9HCE9|ANO8_HUMAN Anoctamin-8 OS=Homo sapiens GN=ANO8 PE=1 SV=3 485 645 9.0E-17
sp|Q75UR0|ANO5_MOUSE Anoctamin-5 OS=Mus musculus GN=Ano5 PE=2 SV=1 108 578 1.0E-16
sp|P86044|ANO9_MOUSE Anoctamin-9 OS=Mus musculus GN=Ano9 PE=2 SV=1 86 612 1.0E-16
sp|Q9BYT9|ANO3_HUMAN Anoctamin-3 OS=Homo sapiens GN=ANO3 PE=1 SV=2 106 600 2.0E-16
sp|Q9NQ90|ANO2_HUMAN Anoctamin-2 OS=Homo sapiens GN=ANO2 PE=1 SV=2 107 578 3.0E-16
sp|Q8BHY3|ANO1_MOUSE Anoctamin-1 OS=Mus musculus GN=Ano1 PE=1 SV=2 159 578 1.0E-15
sp|Q8CFW1|ANO2_MOUSE Anoctamin-2 OS=Mus musculus GN=Ano2 PE=1 SV=2 107 578 3.0E-15
sp|A2AHL1|ANO3_MOUSE Anoctamin-3 OS=Mus musculus GN=Ano3 PE=1 SV=1 106 587 4.0E-13
sp|Q5XXA6|ANO1_HUMAN Anoctamin-1 OS=Homo sapiens GN=ANO1 PE=1 SV=1 345 578 1.0E-11
sp|Q8C5H1|ANO4_MOUSE Anoctamin-4 OS=Mus musculus GN=Ano4 PE=2 SV=2 211 589 1.0E-10
sp|Q32M45|ANO4_HUMAN Anoctamin-4 OS=Homo sapiens GN=ANO4 PE=2 SV=1 211 589 1.0E-10
sp|A6QLE6|ANO4_BOVIN Anoctamin-4 OS=Bos taurus GN=ANO4 PE=2 SV=1 211 589 1.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 180 202 22
2 207 226 19
3 285 307 22
4 317 339 22
5 366 388 22
6 428 450 22
7 506 528 22
8 555 577 22
9 598 620 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2891
MTSLTGNDQHNLGVDYVILFKVPLQERAQAEAAFVQLIQALARVGLSSTVRRGGDSDSLLVFVRAASRERLARHV
RRARMQDWLHGVRTAGPEADASRALKEEPETEAERLRIVYQLISQPINEGGAGVGTSTFVKTVFPLRHQAFNRAW
IQKWSKKRFLEQDDIDEIRNKFGESVALYFAFLRSYSTFIVFPAALGFAAWLLLGQFSYTYALGCGLWSVVFFEY
WKKKELDLAVQWGVRGVSAIQHQRPGFQWEFETEDPITGEPRKVYPYVKRLQTQLLQIPFALASILVLGGLVVFC
NSLEIFINEVYDGPFKQYLAFLPTVFLVVLTPTFSSLLMRAATILTDKENYETSDAYNAALVQKQFVLNFFTSYM
ALLFTTFVYIPFGESLLPLLDLWRKTAQALVSVGGKTLPTQQFHINPQRISSQMFYLTVTAQIVNFVTEVIVPYV
THKAVVKAHEFQVRGPAPQEQDDAEEAEFLKRVREECHLEEYDVTADYREMVMQYGYLALFSVAWPLAACCFLVN
NWVELRSDALKIAISCKRPIPWRADSIGPWLTALGFLSWLGSITSGAIVYLCSHRSRHGPEAAEKSTTTSQLTAW
GGLLSVMLAEHLYLVVQLAVRYVMGKMDSPGLQRERRERYQMKRRLVQESMRGDDDEKTRLDETGVTDRVTRETL
EEEARKASIPGQGSSEDMFWQRQRGAEDTIIIGRRLIEKGVAGEKKKPVPSPGVGG
Coding >Ophio5|2891
ATGACCAGCCTCACAGGCAACGACCAGCACAACCTGGGCGTCGACTACGTCATCCTTTTCAAGGTGCCGCTACAA
GAGCGGGCCCAAGCTGAAGCCGCCTTCGTTCAGCTCATCCAGGCCCTCGCCCGTGTCGGTCTCAGCAGCACGGTT
CGGCGAGGCGGCGATAGCGACTCGCTTCTCGTCTTTGTTCGCGCCGCGTCTCGTGAGCGACTCGCCCGACATGTT
CGGCGAGCGCGTATGCAAGATTGGCTTCACGGTGTGCGCACCGCTGGACCTGAGGCGGATGCTTCGCGCGCGCTC
AAAGAGGAGCCCGAGACCGAGGCCGAGAGGCTACGCATCGTATATCAGCTAATCAGCCAGCCGATCAACGAGGGC
GGCGCGGGTGTTGGCACCTCGACTTTCGTCAAGACTGTGTTTCCCCTTCGCCATCAGGCCTTTAATCGGGCCTGG
ATTCAGAAATGGAGCAAGAAGCGGTTTCTCGAGCAGGACGACATTGACGAGATTCGCAACAAGTTTGGCGAGAGC
GTTGCCTTGTACTTTGCCTTTCTGCGAAGCTACTCGACTTTCATCGTCTTTCCTGCTGCCCTGGGCTTTGCTGCT
TGGTTGCTACTCGGCCAATTCTCTTACACGTATGCCCTTGGCTGCGGCCTCTGGTCTGTCGTCTTCTTCGAGTAC
TGGAAGAAAAAGGAGCTTGATTTGGCCGTCCAATGGGGTGTCCGTGGTGTCTCGGCTATCCAGCATCAGCGTCCG
GGCTTCCAGTGGGAGTTTGAGACGGAGGATCCCATCACGGGCGAGCCCCGCAAGGTCTATCCCTACGTCAAGCGA
CTTCAGACTCAGTTGCTACAGATACCGTTTGCCCTTGCCAGTATCCTTGTCCTCGGCGGCCTCGTCGTCTTCTGC
AATTCGCTTGAGATTTTCATCAACGAGGTCTACGATGGCCCGTTCAAGCAGTACCTGGCCTTTTTACCCACCGTC
TTCCTCGTCGTCTTGACACCTACTTTTTCCTCGCTACTCATGCGTGCTGCCACCATCTTGACTGATAAGGAAAAC
TACGAGACATCAGACGCGTACAACGCGGCCCTCGTGCAGAAGCAGTTTGTCCTCAACTTCTTTACCTCGTACATG
GCCCTGCTCTTCACCACCTTTGTCTATATCCCCTTTGGCGAGTCGCTACTTCCCCTACTTGACCTGTGGAGGAAG
ACGGCGCAGGCACTGGTTAGCGTAGGCGGCAAGACTCTGCCGACGCAGCAATTCCACATCAACCCGCAGCGGATC
AGCAGCCAGATGTTCTACCTGACGGTGACGGCGCAGATTGTCAACTTTGTTACCGAGGTCATCGTGCCTTACGTG
ACGCACAAGGCCGTCGTCAAGGCCCACGAGTTCCAGGTCCGGGGCCCCGCGCCACAGGAGCAGGACGATGCCGAA
GAGGCCGAGTTCCTGAAGCGAGTGCGGGAAGAGTGTCACCTGGAGGAGTACGACGTGACGGCGGATTACAGGGAG
ATGGTGATGCAATACGGCTACCTCGCCCTCTTCTCCGTGGCCTGGCCACTGGCGGCCTGCTGCTTCCTCGTCAAC
AACTGGGTTGAGTTGCGATCGGACGCTTTAAAGATTGCCATCAGCTGCAAGCGGCCAATCCCGTGGCGAGCCGAT
TCCATCGGGCCGTGGCTCACGGCGCTAGGCTTCCTCTCATGGCTGGGCAGCATCACCAGTGGCGCCATCGTCTAC
CTCTGCAGCCACCGATCGCGGCACGGGCCCGAAGCGGCAGAGAAGTCGACGACGACGTCTCAGCTGACGGCATGG
GGAGGCCTCCTCAGCGTCATGTTAGCTGAGCATCTGTACCTTGTCGTCCAGCTGGCGGTGCGATACGTCATGGGG
AAAATGGACAGCCCTGGCCTGCAACGGGAGCGCAGAGAGCGGTACCAGATGAAGAGGAGGCTAGTGCAGGAGAGC
ATGCGCGGCGACGACGACGAAAAGACTCGGCTGGATGAGACGGGCGTGACGGATAGGGTGACGAGGGAAACGCTC
GAGGAGGAGGCACGCAAGGCGTCGATTCCAGGGCAGGGCTCCTCTGAAGACATGTTCTGGCAACGGCAGCGCGGA
GCCGAGGATACCATCATCATTGGACGACGATTGATTGAGAAGGGGGTGGCTGGAGAAAAAAAGAAGCCAGTCCCT
AGTCCCGGAGTGGGAGGA
Transcript >Ophio5|2891
ATGACCAGCCTCACAGGCAACGACCAGCACAACCTGGGCGTCGACTACGTCATCCTTTTCAAGGTGCCGCTACAA
GAGCGGGCCCAAGCTGAAGCCGCCTTCGTTCAGCTCATCCAGGCCCTCGCCCGTGTCGGTCTCAGCAGCACGGTT
CGGCGAGGCGGCGATAGCGACTCGCTTCTCGTCTTTGTTCGCGCCGCGTCTCGTGAGCGACTCGCCCGACATGTT
CGGCGAGCGCGTATGCAAGATTGGCTTCACGGTGTGCGCACCGCTGGACCTGAGGCGGATGCTTCGCGCGCGCTC
AAAGAGGAGCCCGAGACCGAGGCCGAGAGGCTACGCATCGTATATCAGCTAATCAGCCAGCCGATCAACGAGGGC
GGCGCGGGTGTTGGCACCTCGACTTTCGTCAAGACTGTGTTTCCCCTTCGCCATCAGGCCTTTAATCGGGCCTGG
ATTCAGAAATGGAGCAAGAAGCGGTTTCTCGAGCAGGACGACATTGACGAGATTCGCAACAAGTTTGGCGAGAGC
GTTGCCTTGTACTTTGCCTTTCTGCGAAGCTACTCGACTTTCATCGTCTTTCCTGCTGCCCTGGGCTTTGCTGCT
TGGTTGCTACTCGGCCAATTCTCTTACACGTATGCCCTTGGCTGCGGCCTCTGGTCTGTCGTCTTCTTCGAGTAC
TGGAAGAAAAAGGAGCTTGATTTGGCCGTCCAATGGGGTGTCCGTGGTGTCTCGGCTATCCAGCATCAGCGTCCG
GGCTTCCAGTGGGAGTTTGAGACGGAGGATCCCATCACGGGCGAGCCCCGCAAGGTCTATCCCTACGTCAAGCGA
CTTCAGACTCAGTTGCTACAGATACCGTTTGCCCTTGCCAGTATCCTTGTCCTCGGCGGCCTCGTCGTCTTCTGC
AATTCGCTTGAGATTTTCATCAACGAGGTCTACGATGGCCCGTTCAAGCAGTACCTGGCCTTTTTACCCACCGTC
TTCCTCGTCGTCTTGACACCTACTTTTTCCTCGCTACTCATGCGTGCTGCCACCATCTTGACTGATAAGGAAAAC
TACGAGACATCAGACGCGTACAACGCGGCCCTCGTGCAGAAGCAGTTTGTCCTCAACTTCTTTACCTCGTACATG
GCCCTGCTCTTCACCACCTTTGTCTATATCCCCTTTGGCGAGTCGCTACTTCCCCTACTTGACCTGTGGAGGAAG
ACGGCGCAGGCACTGGTTAGCGTAGGCGGCAAGACTCTGCCGACGCAGCAATTCCACATCAACCCGCAGCGGATC
AGCAGCCAGATGTTCTACCTGACGGTGACGGCGCAGATTGTCAACTTTGTTACCGAGGTCATCGTGCCTTACGTG
ACGCACAAGGCCGTCGTCAAGGCCCACGAGTTCCAGGTCCGGGGCCCCGCGCCACAGGAGCAGGACGATGCCGAA
GAGGCCGAGTTCCTGAAGCGAGTGCGGGAAGAGTGTCACCTGGAGGAGTACGACGTGACGGCGGATTACAGGGAG
ATGGTGATGCAATACGGCTACCTCGCCCTCTTCTCCGTGGCCTGGCCACTGGCGGCCTGCTGCTTCCTCGTCAAC
AACTGGGTTGAGTTGCGATCGGACGCTTTAAAGATTGCCATCAGCTGCAAGCGGCCAATCCCGTGGCGAGCCGAT
TCCATCGGGCCGTGGCTCACGGCGCTAGGCTTCCTCTCATGGCTGGGCAGCATCACCAGTGGCGCCATCGTCTAC
CTCTGCAGCCACCGATCGCGGCACGGGCCCGAAGCGGCAGAGAAGTCGACGACGACGTCTCAGCTGACGGCATGG
GGAGGCCTCCTCAGCGTCATGTTAGCTGAGCATCTGTACCTTGTCGTCCAGCTGGCGGTGCGATACGTCATGGGG
AAAATGGACAGCCCTGGCCTGCAACGGGAGCGCAGAGAGCGGTACCAGATGAAGAGGAGGCTAGTGCAGGAGAGC
ATGCGCGGCGACGACGACGAAAAGACTCGGCTGGATGAGACGGGCGTGACGGATAGGGTGACGAGGGAAACGCTC
GAGGAGGAGGCACGCAAGGCGTCGATTCCAGGGCAGGGCTCCTCTGAAGACATGTTCTGGCAACGGCAGCGCGGA
GCCGAGGATACCATCATCATTGGACGACGATTGATTGAGAAGGGGGTGGCTGGAGAAAAAAAGAAGCCAGTCCCT
AGTCCCGGAGTGGGAGGATAA
Gene >Ophio5|2891
ATGACCAGCCTCACAGGCAACGACCAGCACAACCTGGGGTGGGCATCGCCGCTTCACCGAGCAAAACCCTACGCG
CGGCTGACGAGAGGGCAGCGTCGACTACGTCATCCTTTTCAAGGTGCCGCTACAAGGTTGCATCGCCGTTTTTTA
AACCACCCCCCCCCAAACCAGATAGGCGCCTCGACTGACGCGAAAAACACAATCACCAGAGCGGGCCCAAGCTGA
AGCCGCCTTCGTTCAGCTCATCCAGGCCCTCGCCCGTGTCGGTCTCAGCAGCACGGTTCGGCGAGGCGGCGATAG
CGACTCGCTTCTCGTCTTTGTTCGCGCCGCGTCTCGTGAGCGACTCGCCCGACATGTTCGGCGAGCGCGTATGCA
AGATTGGCTTCACGGTGTGCGCACCGCTGGACCTGAGGCGGATGCTTCGCGCGCGCTCAAAGAGGAGCCCGAGAC
CGAGGCCGAGAGGCTACGCATCGTATATCAGCTAATCAGCCAGCCGATCAACGAGGGCGGCGCGGGTGTTGGCAC
CTCGACTTTCGTCAAGACTGTGTTTCCCCTTCGCCATCAGGCCTTTAATCGGGCCTGGATTCAGAAATGGAGCAA
GAAGCGGTTTCTCGAGCAGGACGACATTGACGAGATTCGCAACAAGTTTGGCGAGAGCGTTGCCTTGTACTTTGC
CTTTCTGCGAAGCTACTCGACTTTCATCGTCTTTCCTGCTGCCCTGGGCTTTGCTGCTTGGTTGCTACTCGGCCA
ATTCTCTTACACGTATGCCCTTGGCTGCGGCCTCTGGTCTGTCGTCTTCTTCGAGTACTGGAAGAAAAAGGAGCT
TGATTTGGCCGTCCAATGGGGTGTCCGTGGTGTCTCGGCTATCCAGCATCAGCGTCCGGGCTTCCAGTGGGAGTT
TGAGACGGAGGATCCCATCACGGGCGAGCCCCGCAAGGTCTATCCCTACGTCAAGCGACTTCAGACTCAGTTGCT
ACAGATACCGTTTGCCCTTGCCAGTATCCTTGTCCTCGGCGGCCTCGTCGTCTTCTGCAATTCGCTTGAGATTTT
CATCAACGAGGTCTACGATGGCCCGTTCAAGCAGTACCTGGCCTTTTTACCCACCGTCTTCCTCGTCGTCTTGAC
ACCTACTTTTTCCTCGCTACTCATGCGTGCTGCCACCATCTTGACTGATAAGGAAAACTACGAGACATCAGACGG
TGAGTCTCTGTCCTCGGGAGCCGTCCGTTTCACCGGCTAACTGGTTTCCCCGGCCTTCAGCGTACAACGCGGCCC
TCGTGCAGAAGCAGTTTGTCCTCAACTTCTTTACCTCGTACATGGCCCTGCTCTTCACCACCTTTGTCTATATCC
CCTTTGGCGAGTCGCTACTTCCCCTACTTGACCTGTGGAGGAAGACGGCGCAGGCACTGGTTAGCGTAGGCGGCA
AGACTCTGCCGACGCAGCAATTCCACATCAACCCGCAGCGGATCAGCAGCCAGATGTTCTACCTGACGGTGACGG
CGCAGATTGTCAACTTTGTTACCGAGGTCATCGTGCCTTACGTGACGCACAAGGCCGTCGTCAAGGCCCACGAGT
TCCAGGTCCGGGGCCCCGCGCCACAGGAGCAGGACGATGCCGAAGAGGCCGAGTTCCTGAAGCGAGTGCGGGAAG
AGTGTCACCTGGAGGAGTACGACGTGACGGCGGATTACAGGGAGATGGTGATGCAATACGGTACGTGTCGCGTGT
CCGTGGTCTCGTTGCTGACCGCTTACCGCTTATGTTACGTTCAGGCTACCTCGCCCTCTTCTCCGTGGCCTGGCC
ACTGGCGGCCTGCTGCTTCCTCGTCAACAACTGGGTTGAGTTGCGATCGGACGCTTTAAAGATTGCCATCAGCTG
CAAGCGGCCAATCCCGTGGCGAGCCGATTCCATCGGGCCGTGGCTCACGGCGCTAGGCTTCCTCTCATGGCTGGG
CAGCATCACCAGTGGCGCCATCGTCTACCTCTGCAGCCACCGATCGCGGCACGGGCCCGAAGCGGCAGAGAAGTC
GACGACGACGTCTCAGCTGACGGCATGGGGAGGCCTCCTCAGCGTCATGTTAGCTGAGCATCTGTACCTTGTCGT
CCAGCTGGCGGTGCGATACGTCATGGGGAAAATGGACAGCCCTGGCCTGCAACGGGAGCGCAGAGAGCGGTACCA
GATGAAGAGGAGGCTAGTGCAGGAGAGCATGCGCGGCGACGACGACGAAAAGACTCGGCTGGATGAGACGGGCGT
GACGGATAGGGTGACGAGGGAAACGCTCGAGGAGGAGGCACGCAAGGCGTCGATTCCAGGGCAGGGCTCCTCTGA
AGACATGTCGGTGATTTGCGATTCCTGCAGACGGGCGAGGCTGACATGTGCCTTACCAGGTTCTGGCAACGGCAG
CGCGGAGCCGAGGATACCATCATCATTGGACGACGATTGATTGAGAAGGTATGTCAGTTCCTGCCCTCACTGTTT
GGGTGAGTAGCAAAGAGAGGTTGCTGACAAGAGAGGGGGGGGGGGGGGGGGGGGGGGGGAAAGGGGGTGGCTGGA
GAAAAAAAGAAGCCAGTCCCTAGTCCCGGAGTGGGAGGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail